Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF2

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Caldicellulosiruptor sp. ORF2

Recombinant Caldicellulosiruptor sp. Putative ABC Transporter Permease Protein ORF2 is a bacterial membrane protein produced via heterologous expression for research applications. Derived from Caldicellulosiruptor sp. strain Rt8B.4 (UniProt ID: P40980), this protein belongs to the ATP-binding cassette (ABC) transporter superfamily, which facilitates substrate translocation across cellular membranes using ATP hydrolysis .

Homology and Evolutionary Conservation

ORF2 shares significant homology with ABC permeases involved in nutrient transport across diverse bacterial species (Table 1) .

Table 1: Top Homologs of ORF2 in the ABC Transporter Family

OrganismProtein Name/FunctionIdentityE-valueAccession
Bacillus subtilisABC transporter permease YesQ47.25%2.57e-89O31520
Thermococcus litoralisTrehalose/maltose permease MalG31.99%7.09e-40Q7LYX6
Streptomyces coelicolorDiacetylchitobiose permease DasC30.40%2.58e-39Q9K489
Mycobacterium tuberculosisTrehalose permease SugB32.71%7.15e-36P9WG00
Escherichia colisn-glycerol-3-phosphate permease28.68%2.78e-26A1AGY2

Data sourced from the Biosynthetic Gene Cluster Database

Role in Membrane Stability and Substrate Transport

ABC permeases like ORF2 are critical for maintaining membrane integrity and transporting substrates. For example:

  • PA4455 in Pseudomonas aeruginosa: A homolog implicated in resistance to antimicrobial agents (e.g., EDTA, doxycycline) and membrane stabilization under anaerobic conditions .

  • Ycf1p in Saccharomyces cerevisiae: Mediates vacuolar sequestration of glutathione-conjugated toxins, highlighting ABC transporters' role in detoxification .

Nutrient Uptake and Pathogen Survival

  • In Moraxella catarrhalis, ABC transporters enable survival in nutrient-limited environments by importing peptides, ions, and amino acids .

  • ORF2’s homology to glycerol-3-phosphate and maltose transporters suggests a role in carbohydrate uptake or stress adaptation .

Expression and Purification

  • Host System: Likely expressed in E. coli (exact system unspecified) .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C or -80°C .

Research Applications

  • Drug Resistance Studies: Investigating ABC transporter-mediated efflux mechanisms .

  • Membrane Protein Dynamics: Structural analysis of permease-substrate interactions .

  • Biotechnological Uses: Engineering thermostable transporters for industrial biocatalysis (inferred from Caldicellulosiruptor’s thermophilic nature).

Outstanding Questions and Future Directions

  • Substrate Specificity: Experimental validation of ORF2’s physiological substrates (e.g., sugars, ions).

  • Regulatory Mechanisms: Role of post-transcriptional modifiers (e.g., miRNAs) in ORF2 expression .

  • Structural Studies: High-resolution crystallography to elucidate transport mechanics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Putative ABC transporter permease protein ORF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Caldicellulosiruptor sp. (strain Rt8B.4)
Target Protein Sequence
MSFIKETKKWYFIFLAVWTLIADVPFLFMLFTSFKTQSELLSGNTWQIPRQPTIGNFSTV LEGNFFTYLKNSVIAVSISVVLILIISSMAAFAFSRFKFALNNLLYSLIIAGMAIPIHVT LIPIYVLTNKIKLYDTVFALIGPYVALSLPMSIFILTEFMREIPLELEEAAKIDGCSMFR LYSDILLPLSAPALITVGIYNGTYLWNEFVFALVLTSSPTRRTLPLGIWDFQARYGSDIP AIMAFLTLSLLPMLIAYIFGQDKIIKGMMAGAVKG
Uniprot No.

Target Background

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are ABC transporters and what roles do they play in thermophilic bacteria?

ABC transporters constitute one of the largest families of membrane proteins in most organisms, including thermophilic bacteria like Caldicellulosiruptor sp. These transporters play diverse roles in physiological processes such as nutrient uptake, protein secretion, and resistance to antimicrobial compounds . In thermophilic bacteria, ABC transporters are particularly important for maintaining cellular homeostasis at elevated temperatures.

Structurally, ABC transporters typically consist of transmembrane domains (TMDs), which form the channel through which substrates are transported, and nucleotide-binding domains (NBDs), which bind and hydrolyze ATP to power the transport process. Permease proteins are a type of TMD that forms the transmembrane channel of the ABC transporter complex.

In bacteria, ABC transporters can also be involved in redox processes. For example, the CydDC complex in E. coli exports cysteine and glutathione to the periplasm and is thought to bind haem on the periplasmic surface, which stimulates reductant export and may interact with gaseous signaling molecules .

How are putative ABC transporter genes identified and characterized in thermophilic bacterial genomes?

Identification and characterization of putative ABC transporter genes in thermophilic bacteria involves multiple complementary approaches:

  • Genomic walking PCR (GWPCR): This technique can be used to identify novel genes in bacteria by using primers that bind to known sequences to amplify adjacent unknown sequences .

  • Sequence homology analysis: Once a sequence is obtained, it can be compared to known ABC transporter sequences to identify homologous regions.

  • Domain prediction: Computational tools can identify characteristic ABC transporter domains, such as the ATP-binding cassette (ABC) domain and transmembrane domains.

  • Genomic context analysis: Examining the surrounding genes can provide insights into function, as ABC transporter components are often encoded in operons with genes involved in related processes.

  • Expression and functional studies: Determining expression patterns and conducting knockout or overexpression studies can help characterize the transporter's role.

For example, in one study of Caldibacillus cellulovorans, GWPCR was used to obtain a 4,567-bp nucleotide sequence that revealed three open reading frames (ORFs) . While ORF2 in this case encoded a β-1,4-mannanase rather than an ABC transporter, the methodology demonstrates how novel genes can be identified and subsequently characterized in thermophilic bacteria.

What are the optimal methods for recombinant expression of thermophilic bacterial membrane proteins?

Recombinant expression of thermophilic bacterial membrane proteins, including ABC transporter permease proteins, presents several specific challenges:

  • Selection of expression system: E. coli is commonly used, but for thermophilic proteins, specialized strains designed for expression of membrane proteins or thermophilic hosts may be preferable.

  • Codon optimization: Codon usage in thermophilic bacteria often differs from common expression hosts, necessitating codon optimization of the gene sequence.

  • Vector design: For ORF2 expression from Caldicellulosiruptor sp., inclusion of appropriate restriction sites for directional cloning is crucial. For example, one study used manA-specific primers with NcoI and EcoRI restriction enzyme sites for directional in-frame ligation into expression plasmid pJLA602 .

  • Temperature considerations: Expression conditions should be optimized considering the thermophilic nature of the protein. Lower temperatures during expression may improve folding despite reducing expression rates.

  • Solubilization strategies: Membrane proteins often require detergents or amphipols for solubilization. The selection of appropriate detergents is critical for maintaining protein structure and function.

  • Protein detection methods: For permease proteins that lack enzymatic activity, specialized detection methods are needed. One effective approach is to design constructs with affinity tags or fluorescent protein fusions.

How can researchers assess the functional activity of ABC transporter permease proteins in vitro?

Assessing the functional activity of ABC transporter permease proteins requires specialized approaches:

  • Reconstitution into liposomes: The purified permease protein can be reconstituted into liposomes to create a system that mimics the native membrane environment.

  • Transport assays: Several methods can be employed:

    • Fluorescent substrate accumulation

    • Radiolabeled substrate transport

    • FRET-based assays for conformational changes

  • ATPase activity assays: While permease proteins themselves don't hydrolyze ATP, the activity of the associated nucleotide-binding domains can be measured when co-expressed or reconstituted with the permease.

  • Binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can be used to measure binding of substrates to the permease protein.

  • Structural studies: Techniques such as cryo-electron microscopy can provide insights into the structural changes associated with transport activity.

For thermophilic ABC transporters, it's particularly important to conduct functional assays at physiologically relevant temperatures. Assays should be performed across a range of temperatures to determine optimal conditions, as seen with the ManA enzyme from Caldibacillus cellulovorans, which exhibited optimum activity at 85°C and pH 6.0 .

What bioinformatic approaches are most effective for predicting substrate specificity of uncharacterized ABC transporters?

Predicting substrate specificity of uncharacterized ABC transporters involves several complementary bioinformatic approaches:

  • Phylogenetic analysis: Constructing phylogenetic trees with characterized ABC transporters can provide insights based on evolutionary relationships.

  • Conserved motif identification: Substrate-binding sites often contain conserved motifs that can be identified through multiple sequence alignments.

  • Binding pocket analysis: Homology modeling or ab initio structure prediction can reveal the architecture of potential substrate-binding pockets.

  • Machine learning approaches: Various algorithms can be trained on datasets of characterized ABC transporters to predict substrates for uncharacterized transporters.

  • Genomic context analysis: Co-localization with genes involved in specific metabolic pathways can indicate potential substrates.

These approaches have been successfully applied to various ABC transporters. For example, phylogenetic analysis helped identify Arabidopsis ABCB25/ABC transporter of mitochondria 3 (ATM3) as involved in iron-sulfur cluster and molybdenum cofactor assembly .

How should researchers interpret domain structure in multi-domain proteins from thermophilic bacteria?

Interpretation of domain structure in multi-domain proteins requires careful analysis:

For ABC transporters, typical domain arrangements include nucleotide-binding domains that power transport and transmembrane domains (including permease proteins) that form the substrate translocation pathway. Understanding these domain relationships is crucial for functional characterization.

What strategies can resolve expression and purification challenges specific to thermophilic bacterial membrane proteins?

Researchers face several common challenges when working with thermophilic bacterial membrane proteins:

  • Low expression levels: Strategies to improve expression include:

    • Testing multiple expression strains

    • Optimizing induction conditions (temperature, inducer concentration, duration)

    • Using stronger promoters or specialized expression vectors designed for membrane proteins

    • Incorporating fusion partners that enhance expression and solubility

  • Protein misfolding and aggregation: Address through:

    • Expression at lower temperatures

    • Co-expression with molecular chaperones

    • Addition of specific ligands during expression that stabilize the protein

  • Inefficient extraction and purification:

    • Screen multiple detergents for optimal solubilization

    • Consider nanodisc or amphipol systems for stabilization

    • Employ affinity purification methods with tags positioned to avoid interference with protein function

  • Protein instability post-purification:

    • Add stabilizing ligands or lipids to purification buffers

    • Optimize buffer conditions (pH, salt concentration)

    • Consider protein engineering to enhance stability

  • Loss of function during purification:

    • Validate function at each purification step

    • Maintain proteins in native-like lipid environments

For thermophilic proteins specifically, maintain appropriate temperature conditions throughout purification to prevent misfolding or denaturation at lower temperatures.

How can genomic walking PCR be optimized for identifying novel ABC transporter genes in thermophilic bacteria?

Genomic walking PCR can be optimized for thermophilic bacterial ABC transporter gene identification through the following methodological refinements:

  • Primer design optimization:

    • Design primers based on conserved regions of known ABC transporter genes

    • Use degenerate primers targeting conserved ABC motifs (Walker A, Walker B, ABC signature)

    • Ensure primers have appropriate melting temperatures for thermophilic PCR conditions

  • PCR condition optimization:

    • Use high-fidelity, thermostable DNA polymerases suitable for GC-rich templates

    • Implement touchdown PCR protocols to improve specificity

    • Include PCR additives like DMSO or betaine to deal with secondary structures

  • Multiple walking strategies:

    • Implement bidirectional walking from known sequences

    • Use nested primer approaches to increase specificity

    • Consider adapter-ligated libraries for unbiased walking

  • Sequence verification and analysis:

    • Sequence multiple independent clones to verify accuracy

    • Compare obtained sequences with known ABC transporter genes

    • Analyze for characteristic features like transmembrane domains and ATP-binding motifs

In a study of Caldibacillus cellulovorans, GWPCR using genomic walking primers (GW3F and GW3R) that bind in sequences coding for family IIIb CBDs successfully identified a product that exhibited sequence homology to β-mannanases . Similar approaches can be applied specifically to ABC transporter genes by designing primers targeting conserved ABC transporter motifs.

How should contradictory functional data for putative ABC transporter proteins be reconciled?

When facing contradictory functional data for ABC transporters, apply this systematic reconciliation framework:

  • Methodological evaluation:

    • Assess differences in experimental conditions (pH, temperature, buffer composition)

    • Compare protein preparation methods and purity

    • Evaluate whether full-length proteins or isolated domains were used

  • Substrate specificity considerations:

    • Determine if apparent contradictions result from substrate promiscuity

    • Consider whether different substrates were tested under different conditions

    • Assess whether transport direction was properly controlled and measured

  • Oligomeric state analysis:

    • Verify the oligomeric state of the protein in different experimental setups

    • Determine if reconstitution methods affected assembly of transporter complexes

  • Multi-modal verification:

    • Employ multiple complementary techniques to assess function

    • Combine in vitro biochemical assays with in vivo functional studies

    • Integrate structural data with functional measurements

  • Collaborative cross-validation:

    • Have independent laboratories verify key findings using standardized protocols

    • Establish reference materials for consistent comparison

This approach acknowledges that ABC transporters often operate in complex systems with multiple interacting components. For example, the CydDC complex in E. coli was found to have multiple functions: exporting cysteine and glutathione to the periplasm, binding haem on the periplasmic surface, and potentially interacting with gaseous signaling molecules .

What considerations are important when interpreting sequence similarities between ABC transporters across different thermophilic species?

Interpreting sequence similarities between ABC transporters across thermophilic species requires careful consideration of several factors:

When comparing ABC transporters specifically, special attention should be given to the conservation of signature motifs like the Walker A and B motifs, which are crucial for ATP binding and hydrolysis, and to the transmembrane domains that determine substrate specificity.

How can structural biology techniques be applied to thermophilic ABC transporter permease proteins?

Structural biology offers powerful approaches for studying thermophilic ABC transporter permease proteins:

  • X-ray crystallography:

    • Advantages: High resolution structure determination

    • Challenges: Membrane proteins are difficult to crystallize

    • Thermophilic adaptations: Proteins from thermophiles often have enhanced stability, potentially improving crystallization success

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: Does not require crystallization; can capture multiple conformational states

    • Challenges: Sample preparation and image processing complexity

    • Recent advances: New detectors and processing algorithms have improved resolution for membrane proteins

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Advantages: Can provide dynamic information; works in solution

    • Challenges: Size limitations; complexity of spectra for large proteins

    • Applications: Better suited for individual domains than full transporters

  • Small-angle X-ray scattering (SAXS):

    • Advantages: Can provide envelope information in solution

    • Applications: Useful for studying conformational changes during transport cycle

  • Molecular dynamics simulations:

    • Advantages: Can model protein behavior in membrane environments

    • Applications: Particularly valuable for studying thermostability mechanisms

For thermophilic ABC transporters specifically, these techniques can reveal the structural basis of thermostability and how structural adaptations contribute to function at elevated temperatures. Understanding these relationships can inform engineering efforts to enhance stability of mesophilic transporters for biotechnological applications.

What are the emerging techniques for studying ABC transporter dynamics in native-like environments?

Recent technological advances have enabled more sophisticated studies of ABC transporter dynamics:

  • Native mass spectrometry:

    • Allows analysis of intact membrane protein complexes

    • Can detect bound nucleotides, lipids, and substrates

    • Reveals stoichiometry and stability of complexes

  • Single-molecule FRET:

    • Monitors conformational changes in real-time

    • Can detect rare or transient states missed by ensemble methods

    • Enables correlation of ATP hydrolysis with conformational changes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and conformational dynamics

    • Identifies regions involved in substrate binding

    • Requires less protein than structural techniques

  • Nanodiscs and lipid bilayer systems:

    • Provide native-like membrane environment

    • Enable functional studies in defined lipid compositions

    • Compatible with various biophysical techniques

  • High-speed atomic force microscopy (HS-AFM):

    • Visualizes conformational changes at nanometer resolution

    • Works in physiological conditions

    • Can track dynamics of individual transporter molecules

  • In-cell structural biology:

    • Techniques like in-cell NMR and electron tomography

    • Studies transporters in their native cellular environment

    • Addresses how cellular factors influence transporter function

These approaches are particularly valuable for thermophilic ABC transporters, as they can be employed across temperature ranges to understand how dynamics change with temperature—a critical factor for proteins that function at elevated temperatures.

How can insights from thermophilic ABC transporters be applied to enhance biotechnological processes?

Research on thermophilic ABC transporters offers several biotechnological applications:

  • Bioremediation technologies:

    • ABC transporters from thermophiles can export toxic compounds at elevated temperatures

    • Potential applications in thermophilic bioremediation of contaminated industrial sites

    • Engineering of thermostable transporters for enhanced heavy metal extraction

  • Industrial enzyme production:

    • Transport systems for improved secretion of industrial enzymes

    • Enhanced product yields through optimized export mechanisms

    • Reduced contamination risk in high-temperature fermentation processes

  • Biofuel production:

    • Improved substrate uptake systems for thermophilic ethanologenic bacteria

    • Enhanced tolerance to inhibitory compounds in lignocellulosic hydrolysates

    • More efficient product export to reduce feedback inhibition

  • Paper industry applications:

    • Similar to how ManAd3 enzyme treatment of oxygen-delignified kraft pulp resulted in improved brightness and lower kappa numbers , engineered ABC transporters could facilitate delivery of active enzymes to pulp material

TreatmentKappa No.Brightness (% ISO)Total Bleached Pulp Yield (%)
Control4.653.995.3
ManAd34.055.695.5
XynB33.460.094.7
XynB3 + ManAd33.160.793.4
  • Pharmaceutical applications:

    • Thermostable transport systems for drug delivery

    • Understanding substrate specificity for improved drug design

    • Development of inhibitors for bacterial ABC transporters as novel antibiotics

What are the most significant unresolved questions in thermophilic ABC transporter research?

Several critical questions remain unresolved in the field of thermophilic ABC transporter research:

  • Thermostability mechanisms:

    • How do specific structural adaptations contribute to thermostability?

    • What roles do membrane lipid interactions play in thermostability?

    • Are there universal principles of thermostability across diverse ABC transporter families?

  • Substrate specificity determinants:

    • What structural features determine substrate specificity in thermophilic ABC transporters?

    • How does substrate specificity evolve in thermophiles compared to mesophiles?

    • Can substrate specificity be predicted from sequence alone?

  • Coupling mechanisms:

    • How is ATP hydrolysis coupled to transport at elevated temperatures?

    • Do thermophilic ABC transporters show different coupling efficiencies?

    • What conformational changes are unique to thermophilic transporters?

  • Physiological roles:

    • What unique substrates are transported by thermophilic ABC transporters?

    • How do transport systems contribute to survival in extreme environments?

    • What is the relationship between ABC transporters and other cellular processes in thermophiles?

  • Evolutionary questions:

    • Did thermophilic ABC transporters evolve from mesophilic ancestors or vice versa?

    • What is the relative importance of vertical inheritance versus horizontal gene transfer?

    • How rapidly do ABC transporters adapt to changes in environmental temperature?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, genetics, and computational methods. The answers will not only advance our understanding of thermophilic biology but also provide insights applicable to protein engineering and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.