Recombinant Calditerrivibrio nitroreducens Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

SecD is a core component of the SecDF-YajC subcomplex within the Sec translocase system, which facilitates protein translocation across bacterial membranes . In Calditerrivibrio nitroreducens, a thermophilic, nitrate-reducing bacterium isolated from hot springs, SecD (encoded by the secD gene, locus tag Calni_1242) collaborates with SecF to maintain proton motive force (PMF) during ATP-independent translocation steps . The recombinant form is expressed in E. coli for experimental use, with a purity ≥85% and storage in Tris-based buffer with 50% glycerol .

Functional Role in Protein Translocation

The SecD-SecF complex enhances protein secretion efficiency by:

  • PMF Utilization: Coupling proton gradients to drive post-translational translocation .

  • Chaperone Activity: Stabilizing unfolded preproteins during export .

  • Interactions: Associating with SecYEG and YajC to form a translocon supercomplex .

In C. nitroreducens, SecD’s role may extend to supporting extracellular electron transfer (EET), a trait linked to its nitrate-reducing metabolism .

Expression and Purification

  • Host System: Expressed in E. coli with optional tags (e.g., His-tag) .

  • Purity: ≥85% verified by SDS-PAGE .

  • Reconstitution: Solubilized in deionized water with glycerol (5–50%) for stability .

Key Studies

Study FocusFindingsSource
Genomic ContextsecD (Calni_1242) is part of a 2.2 Mb genome with 2,128 coding sequences .
Mechanistic InsightsSecDF homologs use PMF to act as membrane-integrated chaperones .
Biotechnological RelevanceUsed in ELISA and structural studies due to thermostability .

Biochemical and Genomic Data

  • Genomic Location: Chromosomal locus Calni_1242 .

  • Thermostability: Optimal activity at 55°C, reflecting C. nitroreducens’ thermophilic nature .

  • Taxonomic Uniqueness: C. nitroreducens’ SecD shares <30% sequence identity with E. coli SecD, highlighting evolutionary divergence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize development according to your specification.
Synonyms
secD; Calni_1242; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-517
Protein Length
full length protein
Species
Calditerrivibrio nitroreducens (strain DSM 19672 / NBRC 101217 / Yu37-1)
Target Names
secD
Target Protein Sequence
MQLKLRWITILIVFVVSLFFMFPLDKRINLGLDLKGGMHVILGVETEKAVQAKIDTLTGQ IRKELRNSKINFAFVQKNESGKISIGLSDPAERNKVKDLISKNYPILKESGLNSDEKVIE LSLDTDEVKRIKDYAVEQAVQVIRNRVDQFGVNEPVIQRQGKEHILVQLAGITDPERAVK LIGKTAQLKFYLLDENANNEETIKSGNIPPDDIILYGKKIDKVTGQIVSTIPYVLKKDAV LTGDYLLEAEVRISSQFNEPYVSIKFDPAGSKIFEEITAENVNKRMAIVLDDNVYSAPVI RERIAGGEAQISGSFTLEEAKDLAIVLRAGSLPAPVKILENRTIGPSLGQDSIKKGIWAG IIGVAAVIIFMLIYYKFSGFIASIALLSNAIIILGAMGMFKATLTLPGIAGLILTMGMAI DANVLIFERIREELRLGRTPMNALEAGFEKAMSTIIDSNITTLIAGLVLFQFGTGPVKGF AVTLTIGILSSIFTAVTLSKTIFLTLYGNKEIKKLSV
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Protein translocase subunit SecD in Calditerrivibrio nitroreducens?

SecD is an integral cytoplasmic membrane protein that forms part of the bacterial Sec translocation machinery, which is responsible for transporting proteins across the bacterial membrane. In Calditerrivibrio nitroreducens, SecD functions as a component of an evolutionarily conserved supercomplex with SecYEG, along with other integral membrane proteins including SecF, YidC, and YajC . This complex is essential for maintaining protein homeostasis by ensuring proper localization of exported proteins. Specifically, SecD enhances the efficiency of protein translocation across the membrane by preventing backsliding of translocating polypeptides, thereby maintaining the directionality of translocation . C. nitroreducens, a moderately thermophilic nitrate-reducing bacterium from hot springs, likely requires robust protein translocation machinery to maintain cellular function in its thermophilic environment .

How does the SecD protein function within the Sec translocation machinery?

SecD operates as part of the accessory complex that assists the core SecYEG translocon during protein translocation. Methodologically, SecD functions by facilitating the final stages of protein export in several ways. First, it helps maintain the proton-motive force (PMF) that supports vectorial translocation of proteins . Second, it prevents backward movement of partially translocated proteins, acting as a ratchet mechanism. Third, it may assist in the release of fully translocated proteins from the SecYEG channel into the periplasmic space.

The current model suggests that during SecA-dependent translocation, the two-helix finger (2HF) of SecA pushes the polypeptide into the SecY channel upon ATP binding. SecD, along with SecF, acts during this process to prevent backsliding of the polypeptide, particularly after ATP hydrolysis when the polypeptide could potentially slide backward . This activity becomes especially important during the ADP-bound state of SecA when the polypeptide clamp is open.

What genomic and structural characteristics are known about SecD in C. nitroreducens?

C. nitroreducens has a 2,216,552 bp genome with 2,128 protein-coding genes . The secD gene encoding the Protein translocase subunit SecD is among these protein-coding sequences. While specific structural data for C. nitroreducens SecD is limited, comparative genomics approaches can be used to predict its structure based on homologs from related organisms.

FeatureCharacteristic in C. nitroreducens
Genome size2,216,552 bp
Total protein-coding genes2,128
Growth temperatureModerately thermophilic
Physiological characteristicsStrictly anaerobic, motile, Gram-negative, chemoorganoheterotroph
HabitatHot springs
Taxonomic classificationFamily Deferribacteraceae

Researchers studying the structure of C. nitroreducens SecD should consider that as a thermophilic organism, its SecD may possess adaptations for enhanced thermostability compared to mesophilic homologs, potentially including increased hydrophobic interactions, additional salt bridges, or modified loop regions.

What expression systems are most suitable for recombinant production of C. nitroreducens SecD?

To address membrane protein expression challenges, consider using E. coli strains specifically engineered for membrane protein expression, such as C41(DE3) or C43(DE3). Additionally, fusion tags such as MBP (maltose-binding protein) or SUMO can improve solubility. For thermophilic proteins like those from C. nitroreducens, expression at lower temperatures (16-20°C) for extended periods often improves proper folding despite the seeming paradox of expressing thermophilic proteins at low temperatures.

Alternative expression systems worth considering include:

  • Cell-free expression systems supplemented with lipids or detergents

  • Bacillus subtilis-based systems (closer phylogenetic relation to Deferribacteraceae)

  • Yeast systems (P. pastoris) for eukaryotic processing capabilities

  • Thermophilic expression hosts for potentially better folding

Each system offers different advantages in terms of yield, proper folding, and post-translational modifications.

How can researchers optimize purification protocols for recombinant C. nitroreducens SecD?

Purification of recombinant C. nitroreducens SecD requires specialized methodologies for membrane proteins. Begin with careful membrane isolation through differential centrifugation following cell lysis. For solubilization, select detergents carefully based on protein stability and downstream applications. Initial screens should include mild detergents like DDM (n-dodecyl-β-D-maltoside), LMNG (lauryl maltose neopentyl glycol), or digitonin.

A methodological purification workflow should include:

  • Membrane preparation through ultracentrifugation steps

  • Solubilization in selected detergent (3-5× critical micelle concentration)

  • Initial capture through affinity chromatography (typically IMAC for His-tagged constructs)

  • Secondary purification through size exclusion or ion exchange chromatography

  • Quality assessment via SDS-PAGE, western blotting, and if possible, mass spectrometry

When designing purification protocols, consider that C. nitroreducens proteins may retain activity at higher temperatures, which can be leveraged as a purification step through heat treatment of E. coli lysates to precipitate host proteins while retaining the thermostable target protein. Additionally, the use of stabilizing additives like glycerol (10-15%) and specific lipids may enhance protein stability during purification.

What experimental approaches can verify the functionality of purified recombinant SecD?

Verifying the functionality of purified recombinant C. nitroreducens SecD requires assays that test its native activities within the Sec translocation machinery. Since SecD functions as part of a complex, complete functional verification often requires reconstitution with partner proteins.

Methodological approaches to verify functionality include:

  • Proteoliposome reconstitution assays: Reconstitute purified SecD along with SecF, SecYEG, and SecA into liposomes, then measure translocation of model substrates.

  • ATPase stimulation assays: While SecD itself is not an ATPase, its presence should enhance the ATPase activity of SecA during translocation. Measure SecA ATP hydrolysis rates with and without SecD present.

  • Binding assays: Assess binding interactions between SecD and other Sec components using techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or pull-down assays.

  • Crosslinking studies: Use chemical crosslinking followed by mass spectrometry to verify interactions between SecD and other components of the translocation machinery .

  • Complementation assays: Test whether C. nitroreducens SecD can complement secD-deficient E. coli strains, which would demonstrate functional conservation.

Remember that as a moderately thermophilic protein, C. nitroreducens SecD may display optimal activity at elevated temperatures (40-60°C), so activity assays should be performed across a temperature range.

How can researchers study the interaction between SecD and other components of the Sec machinery?

Studying interactions between C. nitroreducens SecD and other Sec components requires sophisticated biophysical and biochemical approaches. Methodologically, researchers can employ several complementary techniques to build a comprehensive picture of these interactions:

When designing these experiments, researchers should consider the known domain structure of SecD and its large periplasmic domain, which is likely involved in interactions with translocating polypeptides and possibly with the periplasmic domains of other Sec components.

What are the challenges in studying SecD dynamics during protein translocation?

Studying the dynamics of C. nitroreducens SecD during protein translocation presents several methodological challenges. Since protein translocation is a multistep process involving conformational changes in both the translocon and the substrate, capturing these dynamic events requires specialized approaches.

A major challenge is that SecD functions as part of a multiprotein complex embedded in the membrane, making it difficult to isolate its specific contributions to the translocation process. Additionally, the thermophilic nature of C. nitroreducens may necessitate performing experiments at elevated temperatures, adding technical complexity.

Methodological approaches to address these challenges include:

  • Time-resolved structural studies: Use methods like time-resolved cryo-EM or HDX-MS to capture different conformational states of SecD during the translocation cycle.

  • Single-molecule tracking: Employ techniques like single-molecule FRET or optical tweezers to track conformational changes in real-time during translocation .

  • Molecular dynamics simulations: Use computational approaches to model SecD dynamics based on available structural data of homologous proteins.

  • Disulfide crosslinking: Introduce cysteine pairs at strategic locations to trap specific conformational states through disulfide bond formation.

The key to success in these studies is to design experiments that can distinguish between different states of the translocation cycle, particularly focusing on how SecD contributes to preventing backward movement of translocating polypeptides and maintaining the proton-motive force coupling .

How does the thermostability of C. nitroreducens SecD compare to mesophilic homologs?

Investigating the thermostability of C. nitroreducens SecD compared to mesophilic homologs provides valuable insights into protein adaptation to extreme environments. As C. nitroreducens is moderately thermophilic, its SecD likely possesses structural adaptations that enhance stability at elevated temperatures .

Methodological approaches to characterize these thermostability differences include:

  • Differential scanning calorimetry (DSC): Measure the thermal denaturation profiles of purified C. nitroreducens SecD compared to homologs from mesophilic bacteria (e.g., E. coli).

  • Circular dichroism (CD) spectroscopy: Monitor temperature-dependent changes in secondary structure elements to determine melting temperatures.

  • Limited proteolysis at different temperatures: Assess the resistance to proteolytic degradation across a temperature range.

  • Comparative sequence and structure analysis: Identify amino acid compositions and structural features associated with thermostability, such as increased hydrophobic interactions, additional salt bridges, or shortened loop regions.

FeatureTypical adaptations in thermophilic proteinsPotential locations in SecD
Amino acid compositionIncreased Arg, Glu, Pro; decreased Ala, His, CysThroughout sequence
Electrostatic interactionsMore salt bridgesInterface regions
Hydrophobic interactionsEnhanced core packingTransmembrane regions
Structural elementsShorter loops, increased α-helical contentPeriplasmic domain
Proline contentHigher in loopsTurn regions

Understanding these adaptations can inform protein engineering efforts to enhance the stability of membrane proteins for biotechnological applications.

What methodologies are most effective for studying the role of SecD in maintaining translocation directionality?

The role of SecD in maintaining the directionality of protein translocation is a sophisticated aspect of its function. Current models suggest that SecD, along with SecF, helps prevent backward sliding of translocating polypeptides, particularly after ATP hydrolysis by SecA when the polypeptide could potentially move backward .

Effective methodological approaches to study this specific function include:

  • In vitro translocation assays with defined arrest points: Design substrate proteins with domains that can be arrested at specific stages of translocation, then measure how SecD affects the tendency for backward movement.

  • Single-molecule force measurements: Use optical tweezers or magnetic tweezers to apply force to translocating polypeptides and measure how the presence of SecD affects the force required for backward movement.

  • High-resolution cryo-EM of translocation intermediates: Capture structures of the Sec machinery with a translocating polypeptide at different stages to visualize how SecD interacts with the substrate.

  • PMF uncoupling experiments: Since SecD is thought to couple the PMF to translocation, design experiments that specifically disrupt this coupling (e.g., using protonophores or SecD mutations) and measure effects on translocation directionality.

  • Real-time fluorescence assays: Develop assays using fluorescently labeled substrates that can report on their position in the translocation channel.

These approaches should be combined with site-directed mutagenesis of conserved SecD residues to identify specific molecular determinants of its function in maintaining translocation directionality .

What are common challenges in expressing and purifying functional C. nitroreducens SecD and how can they be overcome?

Recombinant expression of C. nitroreducens SecD presents several challenges common to membrane proteins, compounded by its thermophilic origin. Researchers frequently encounter issues with protein misfolding, aggregation, toxicity to host cells, and low yields.

Several methodological strategies can address these challenges:

  • Addressing toxicity: Use tightly regulated expression systems and consider reduced culture temperatures during induction. The pLysS strain can help control basal expression levels for T7-based systems.

  • Improving membrane integration: C. nitroreducens SecD may not properly integrate into E. coli membranes. Consider using specialized E. coli strains with enhanced membrane protein expression capabilities like C41(DE3), C43(DE3), or Lemo21(DE3).

  • Preventing aggregation: Express at lower temperatures (16-20°C) despite C. nitroreducens being thermophilic. Add glycerol (10%) and specific lipids to extraction and purification buffers.

  • Optimizing solubilization: Screen multiple detergents systematically. Beyond conventional detergents like DDM, consider newer amphipathic polymers like SMALPs (styrene-maleic acid lipid particles) that can extract membrane proteins with their native lipid environment intact.

  • Addressing proteolytic degradation: Include multiple protease inhibitors in all buffers and consider using E. coli strains deficient in specific proteases.

If conventional approaches fail, consider more specialized techniques like cell-free expression systems with supplied lipids or detergents, or fusion with proteins known to enhance membrane protein folding and stability.

How can researchers distinguish between functionally active and inactive conformations of recombinant SecD?

Distinguishing between functionally active and inactive conformations of recombinant C. nitroreducens SecD requires assays that specifically probe its conformational state. This is particularly important since membrane proteins can adopt non-native conformations during recombinant expression and purification.

Methodological approaches to assess conformational integrity include:

  • Limited proteolysis profiles: Active and inactive conformations often show different susceptibility to protease digestion. Compare proteolysis patterns of your recombinant SecD with those of known active preparations.

  • Intrinsic fluorescence spectroscopy: Monitor the fluorescence of tryptophan residues, which can reveal conformational states based on the local environment of these residues.

  • Circular dichroism spectroscopy: Assess secondary structure content to ensure proper folding.

  • Binding assays with known interaction partners: Active SecD should bind to SecF and other components of the Sec machinery with expected affinities.

  • Activity-based assays: Since SecD enhances protein translocation, compare translocation efficiency in reconstituted systems with and without your SecD preparation.

  • EPR spectroscopy with site-directed spin labeling: This can provide detailed information about specific regions and their conformational dynamics.

By combining multiple approaches, researchers can build confidence in the conformational integrity of their recombinant SecD preparations before proceeding to more complex functional studies.

What are effective strategies for reconstituting C. nitroreducens SecD into membrane mimetics for functional studies?

Reconstituting C. nitroreducens SecD into membrane mimetics is essential for functional studies, as its native environment is the bacterial membrane. Several methodological approaches are available, each with advantages for specific experimental questions:

  • Proteoliposome reconstitution: The most physiologically relevant approach involves incorporating purified SecD into liposomes composed of E. coli lipids or synthetic lipid mixtures. Methodologically, this can be achieved through detergent removal via dialysis, bio-beads, or cyclodextrin. The lipid composition should be optimized, potentially including lipids found in thermophilic bacteria.

  • Nanodiscs: These provide a more defined and homogeneous membrane environment than liposomes. MSP (membrane scaffold protein) nanodiscs can be prepared with precise lipid compositions and protein:lipid ratios, facilitating biophysical studies.

  • Amphipols: These amphipathic polymers can stabilize membrane proteins after detergent removal and may be useful for structural studies.

  • SMALPs: Styrene-maleic acid lipid particles extract membrane proteins with their native lipid environment intact, potentially preserving native interactions.

  • Bicelles: These disc-shaped lipid bilayers surrounded by detergent molecules provide an environment suitable for NMR studies.

For thermophilic proteins like C. nitroreducens SecD, the reconstitution protocol should consider temperature effects on lipid phase transitions and protein stability. Additionally, reconstitution of SecD along with its partner proteins (SecF, YajC) may be necessary to maintain its native conformation and function.

How might CRISPR-Cas9 gene editing be applied to study SecD function in C. nitroreducens?

CRISPR-Cas9 gene editing presents promising opportunities for studying SecD function directly in C. nitroreducens, though this approach faces challenges due to the limited genetic tools available for this non-model thermophilic organism. Methodologically, researchers would need to:

  • Develop transformation protocols for C. nitroreducens, potentially adapting methods used for other thermophilic bacteria.

  • Design thermostable Cas9 variants or use naturally thermophilic Cas proteins, as standard Cas9 may have reduced activity at the growth temperatures of C. nitroreducens.

  • Create customized CRISPR-Cas delivery systems suitable for anaerobic, thermophilic bacteria, potentially using broad-host-range plasmids or specialized transduction systems.

Once established, CRISPR-Cas9 could be applied to:

  • Generate precise point mutations in secD to study structure-function relationships.

  • Create conditional knockdown systems to evaluate SecD essentiality.

  • Introduce reporter tags for visualizing SecD localization and dynamics.

  • Perform domain swapping experiments with secD genes from mesophilic organisms to identify thermostability determinants.

These approaches would provide valuable insights into SecD function in its native context and potentially reveal adaptations specific to protein translocation in thermophilic environments .

What potential applications might emerge from understanding C. nitroreducens SecD structure and function?

Understanding the structure and function of C. nitroreducens SecD could lead to several innovative applications in biotechnology and synthetic biology. As a component of protein translocation machinery from a thermophilic organism , it may offer unique properties valuable for various applications:

  • Enhanced protein secretion systems for industrial enzymes: Thermostable SecD variants could be incorporated into engineered bacteria to improve secretion efficiency of industrial enzymes at elevated temperatures, potentially increasing productivity in biomanufacturing processes.

  • Design of thermostable membrane protein expression systems: Insights from C. nitroreducens SecD could inform the development of expression systems specifically optimized for difficult-to-express membrane proteins.

  • Synthetic biology applications: Components of the C. nitroreducens Sec machinery could be incorporated into minimal cells or synthetic organisms designed to function at higher temperatures.

  • Structural biology tools: Understanding how SecD maintains function at elevated temperatures could provide principles for stabilizing membrane proteins for structural studies.

  • Novel antimicrobial targets: Comparative analysis of SecD between thermophilic and pathogenic bacteria could reveal distinctive features that could be exploited for the development of new antimicrobials targeting the Sec system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.