Recombinant Callicebus donacophilus Cytochrome c oxidase subunit 6C (COX6C)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare according to your specifications.
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare according to your specifications.
Lead Time
Delivery time
may vary depending on the purchasing method and location. Please consult your local distributors
for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We
suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at
-20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature
and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw
cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If
you have a specific tag type requirement, please inform us and we will prioritize developing it.
Synonyms
COX6C; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-75
Protein Length
Full Length of Mature Protein
Species
Plecturocebus donacophilus (Bolivian gray titi monkey) (Callicebus donacophilus)
Target Names
Target Protein Sequence
ASEVLVKPQMRGLLARRLRIHMVGAFLVSLGVAALYKFGVAEPRKKAYADFYKNYSAEKD
FEEMKKAGLFRSIK
Uniprot No.
Target Background
Function
Cytochrome c oxidase subunit 6C (COX6C) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane that powers transmembrane transport and the ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 6c family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
