The Suppressor of Tumorigenicity 7 protein (ST7) is a protein that has garnered interest for its role as a tumor suppressor in human cancer . ST7 is encoded by the ST7 gene, and it is located on chromosome 7q31.1, a region known for harboring tumor suppressor genes . Research indicates that ST7 may mediate tumor suppression by influencing the tumor microenvironment . Recombinant ST7 protein, such as the Callicebus moloch (dusky titi monkey) variant, is produced in systems like E. coli for research purposes .
The ST7 gene encodes the suppressor of tumorigenicity 7 protein . Synonyms for the ST7 gene include HELG, RAY1, SEN4, TSG7, and Fam4a2 . The Callicebus moloch ST7 protein has the UniProt ID Q2QLB7 .
Recombinant Callicebus moloch ST7 protein is produced as a full-length protein (1-585 amino acids) with an N-terminal His tag in E. coli .
| Characteristic | Description |
|---|---|
| Species | Plecturocebus moloch (Dusky titi monkey) (Callicebus moloch) |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-585) |
| Form | Lyophilized powder |
| Amino Acid Sequence | MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPVTSQHFQN |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. |
ST7 functions as a tumor suppressor in human cancer . It can suppress the growth of prostate cancer cells and increase the latency of tumor detection in mouse models . Re-expression of ST7 is associated with the suppression of colony formation in breast cancer cells, and ST7 mRNA expression is often downregulated in primary breast cancers . ST7 induces changes in genes involved in remodeling the extracellular matrix, suggesting that it may mediate tumor suppression through modification of the tumor microenvironment .
ST7 participates in several pathways and has different roles within them . It interacts directly with proteins and molecules, and these interactions are detected through methods like yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays . One protein that interacts with ST7 is NFKBIA .
Mutations in the ST7 gene are rare in primary colorectal cancers, gastric cancers, and hepatocellular carcinomas . Single-nucleotide polymorphisms (SNPs) have been identified in introns of the ST7 gene, but no correlations have been found between these SNPs and clinicopathological data .
Recombinant Full Length Callicebus moloch Suppressor of tumorigenicity 7 protein (ST7) is a protein derived from the Dusky titi monkey (Plecturocebus moloch, formerly classified as Callicebus moloch). The recombinant form typically refers to the full-length protein (spanning amino acids 1-585) with an N-terminal His tag, expressed in E. coli expression systems . ST7 is considered part of a gene family implicated in tumor suppression pathways, making it valuable for cancer research applications.
For optimal experimental outcomes, ST7 protein requires specific handling procedures:
Storage recommendations:
Store lyophilized powder at -20°C to -80°C upon receipt
Aliquot reconstituted protein to avoid repeated freeze-thaw cycles
Reconstitution protocol:
Briefly centrifuge the vial before opening to collect contents at the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage
Avoiding repeated freeze-thaw cycles is crucial for maintaining protein activity and stability.
Callicebus moloch, now reclassified as Plecturocebus moloch (Red-bellied Titi Monkey), belongs to the following taxonomic hierarchy:
| Taxonomic Level | Classification |
|---|---|
| Kingdom | Animalia |
| Phylum | Chordata |
| Class | Mammalia |
| Order | Primates |
| Family | Pitheciidae |
| Scientific Name | Plecturocebus moloch (Hoffmannsegg, 1807) |
| Synonym | Callicebus moloch (Hoffmannsegg, 1807) |
Common names include Red-bellied Titi Monkey, Dusky Titi, and Titi Monkey . This species serves as an important non-human primate model for comparative genomic studies of tumor suppressor genes across evolutionarily related species.
While ST7 protein functions as a potential tumor suppressor, research has identified a related long non-coding RNA called ST7-AS1 that appears to have significant roles in cancer biology:
ST7-AS1 expression is frequently downregulated in breast cancer tissues compared to normal tissue
Low ST7-AS1 expression correlates with advanced clinical pathologic characteristics including high grade, histological type, age, menopause status, and HER2 status
ST7-AS1 expression levels show correlation with survival time and prognosis in breast cancer patients
Copy Number Variations (CNVs) in ST7-AS1 can cause gene disorder in downstream cancers, linked to proliferation, apoptosis, and cell migration
The functional relationship between ST7 protein and ST7-AS1 suggests complex regulatory mechanisms that may be exploited for cancer diagnostics and therapeutics.
When designing experimental approaches to investigate ST7's role in tumor suppression:
Protein interaction studies:
Use purified recombinant ST7 with His-tag for pull-down assays to identify binding partners
Perform co-immunoprecipitation experiments with epitope-tagged ST7 in cellular lysates
Employ yeast two-hybrid screening to identify novel protein-protein interactions
Functional rescue experiments:
In cell lines with ST7 knockdown/knockout, introduce recombinant ST7 to assess rescue of phenotype
Compare wild-type versus mutant forms of recombinant ST7 protein to map functional domains
Structural biology approaches:
These methodological approaches can help elucidate ST7's role in complex cellular pathways involved in tumor suppression.
Research on ST7 and its related gene products has revealed significant correlations with clinical features in cancer:
| Clinical Feature | Correlation with Low ST7-AS1 Expression | p-value |
|---|---|---|
| T stage | Higher proportion of T3/T4 tumors | 0.002 |
| N stage | No significant correlation | 0.419 |
| M stage | No significant correlation | 0.396 |
These findings suggest that reduced expression of ST7-related genes may be associated with more advanced primary tumor characteristics but not necessarily with nodal or metastatic spread . Such correlations highlight the potential value of ST7 as a prognostic biomarker in certain cancers.
Analysis of ST7-related gene expression has revealed important correlations with immune cell infiltration in the tumor microenvironment:
ST7-AS1 expression shows correlation with specific immune cell populations:
Research methodologies to investigate these associations include:
Understanding these relationships may provide insights into how ST7 influences tumor immune surveillance and potential immunotherapeutic approaches.
Based on gene ontology (GO) analysis and gene set enrichment analysis (GSEA), ST7-related genes have been implicated in cell cycle and DNA repair processes . Researchers investigating these functions should consider:
Cell cycle analysis techniques:
Flow cytometry with propidium iodide staining to assess cell cycle distribution
BrdU incorporation assays to measure S-phase entry
Time-lapse microscopy with ST7-expressing versus ST7-knockout cells
DNA repair capacity assessment:
Comet assay to measure DNA damage repair kinetics
γ-H2AX foci formation to quantify double-strand break repair
Reporter assays for specific DNA repair pathways (HR, NHEJ)
Pathway analysis:
These methodological approaches provide a comprehensive framework for investigating ST7's functional roles in cellular processes critical to cancer development and progression.
To develop robust prognostic models using ST7 expression:
Statistical approach:
Validation methodology:
Evaluate discrimination ability through receiver operating characteristic (ROC) analysis
Assess correlation between clinical characteristics and gene expression using appropriate statistical tests (Chi-squared test, Fisher exact test, Kruskal–Wallis test, etc.)
Employ R statistical software (Version 3.5.1 or later) for comprehensive analysis
Implementation strategy:
Combine ST7 expression data with established clinical prognostic factors
Validate findings across multiple patient cohorts
Consider integration with other molecular biomarkers for improved prognostic power
This systematic approach ensures that ST7-based prognostic models have robust statistical foundation and clinical utility.
When planning experiments using recombinant Callicebus moloch ST7 protein:
Protein preparation:
The N-terminal His-tagged form (available commercially) offers advantages for purification and detection
Purity greater than 90% as determined by SDS-PAGE is generally suitable for most applications
Consider the buffer composition (Tris/PBS-based buffer, 6% Trehalose, pH 8.0) when designing experiments
Experimental controls:
Include appropriate negative controls (e.g., irrelevant His-tagged protein of similar size)
Consider species-specific differences when extrapolating findings to human systems
Validate antibody specificity for detection of recombinant versus endogenous ST7
Functional assays:
Select cell lines with defined ST7 expression levels
Consider transfection efficiency and expression levels in overexpression studies
Design time-course experiments to capture dynamic processes
These considerations help ensure experimental rigor and reproducibility when working with recombinant ST7 protein.
When faced with conflicting results across cancer types or experimental systems:
Contextual analysis:
Consider tissue-specific effects of ST7 (expression patterns may vary across tissues)
Evaluate the role of ST7 in relation to specific oncogenic drivers in each cancer type
Assess potential differences in ST7 splice variants or post-translational modifications
Methodological variations:
Examine differences in experimental approaches (in vitro vs. in vivo models)
Consider variations in ST7 detection methods (antibodies, mRNA quantification)
Evaluate statistical power and sample sizes across studies
Integrative approach:
Combine findings from multiple methodologies (genomic, transcriptomic, proteomic)
Consider evolutionary conservation of ST7 function across species
Apply bioinformatic approaches to resolve apparent contradictions
This systematic framework helps researchers navigate discrepancies in the literature and develop coherent models of ST7 function.
Based on current knowledge, several key areas warrant further investigation:
Mechanistic studies:
Elucidate the precise molecular mechanisms by which ST7 and ST7-AS1 influence cell cycle and DNA repair
Investigate the relationship between ST7 protein function and lncRNA ST7-AS1 regulatory networks
Map the signaling pathways downstream of ST7 in normal and malignant cells
Clinical applications:
Develop ST7-based prognostic models with improved accuracy for patient stratification
Explore therapeutic strategies targeting ST7 pathways in cancers with aberrant expression
Investigate ST7 as a biomarker for response to specific cancer treatments
Comparative biology:
Compare ST7 function across primate species to understand evolutionary conservation
Examine species-specific differences in ST7 regulation and activity
Utilize the Callicebus moloch model for insights applicable to human cancer biology
These research directions hold potential for translating basic knowledge about ST7 into clinically relevant applications for cancer diagnosis and treatment.