Recombinant Callimico goeldii Cytochrome c oxidase subunit 2 (MT-CO2) is a transmembrane protein that is a subunit of cytochrome c oxidase, an enzyme complex essential for the electron transport chain in mitochondria . Cytochrome c oxidase, also known as Complex IV, plays a vital role in cellular respiration by catalyzing the transfer of electrons to oxygen, generating water, and contributing to the proton gradient that drives ATP synthesis . Callimico goeldii is Goeldi's marmoset.
The amino acid sequence of Recombinant Callimico goeldii Cytochrome c oxidase subunit 2 (MT-CO2) is :
LGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMI
WT
ILPAVILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYI
TPTY
FLEPGEFRLLEVDNRTTLPMEADIRVLISSQDVLHSWAVPALGVKTDAIPGRLN
QAMLTS TRPGLYYGQCSEICGSNHSFMPIVLEFIYFQDFEVW
Cytochrome c oxidase (Complex IV) is the terminal enzyme of the mitochondrial respiratory chain . It catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing it to water. This process is coupled with the translocation of protons across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis by ATP synthase .
Subunit 2 (MT-CO2) is a core subunit of the cytochrome c oxidase complex and is directly involved in the electron transfer process . It contains the binding site for cytochrome c and plays a crucial role in the redox reactions of the enzyme.
Cytochrome c oxidase is essential for energy production in eukaryotic cells . Defects in cytochrome c oxidase activity have been implicated in various human diseases, including mitochondrial myopathies, neurodegenerative disorders, and aging .
Cytochrome c oxidase subunit 2 is highly conserved across different species, reflecting its critical function . Comparative studies of MT-CO2 sequences in different organisms can provide insights into the evolution of the respiratory chain and the adaptation of organisms to different environments.
Recombinant Callimico goeldii MT-CO2 is typically produced using an E. coli expression system. The full-length protein (residues 1-216) is expressed with an N-terminal His-tag to facilitate purification . The production process involves:
Cloning the MT-CO2 gene into an expression vector
Transformation into E. coli
Induction of protein expression
Cell lysis and extraction
Affinity purification using the His-tag
Further purification steps to achieve >90% purity as determined by SDS-PAGE
The resulting recombinant protein has a molecular weight of approximately 24.8 kDa and contains the complete functional domains of the native protein .
For optimal stability and activity, recombinant MT-CO2 should be stored according to the following guidelines:
Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom .
Comparing the MT-CO2 from Callimico goeldii (216 amino acids) with that from Arvicanthis somalicus (227 amino acids) reveals interesting structural differences:
| Feature | Callimico goeldii MT-CO2 | Arvicanthis somalicus MT-CO2 |
|---|---|---|
| Length | 216 amino acids | 227 amino acids |
| UniProt ID | P50661 | Q38S26 |
| Sequence homology | Reference | Differs in length and composition |
Despite these differences, the core functional domains related to electron transfer are generally conserved across species, reflecting the essential role of this protein in cellular respiration . In studies of other species, interpopulation divergence at the COII locus can be significant - in the marine copepod Tigriopus californicus, nearly 20% divergence at the nucleotide level was observed, including 38 nonsynonymous substitutions .
Several methodological approaches can be employed to study MT-CO2 function:
Biochemical assays:
Structural biology techniques:
Molecular biology approaches:
Evolutionary analyses:
When designing experiments, researchers should consider that MT-CO2 interacts with nuclear-encoded subunits that may have tissue-specific isoforms, potentially affecting functional outcomes .
MT-CO2 forms critical interactions with both mitochondrial-encoded and nuclear-encoded subunits of the cytochrome c oxidase complex, as well as with its electron donor, cytochrome c:
Interactions with cytochrome c:
Interactions with MT-CO1:
Assembly interactions:
Research indicates that despite the high conservation of catalytic function, there is evidence for co-evolution between MT-CO2 and its interacting partners, particularly in primate lineages where 11 charge-bearing residues involved in binding cytochrome c have been replaced with uncharged residues .
Evolutionary analyses of MT-CO2 in primates reveal fascinating patterns of selection and adaptation:
Accelerated evolution in anthropoid primates:
Codon-specific selection patterns:
Co-evolution with nuclear genome:
There is evidence for co-evolution between MT-CO2 and nuclear-encoded subunits of COX
This pattern reflects the need to maintain compatible interactions between proteins encoded by two different genomes
The high degree of interaction between MT-CO2 and nuclear-encoded components suggests that some codons may be under positive selection to compensate for amino acid substitutions in other subunits
This evolutionary pattern has been described as a "domestication scenario" where the nuclear genome increasingly controls the ancestral activity of MT-CO2, emphasizing the importance of regulatory adaptation in mitochondrial function evolution .
Studying the role of MT-CO2 in hypoxia adaptation requires sophisticated methodological approaches:
Comparative expression analysis:
Quantifying MT-CO2 expression levels under normoxic versus hypoxic conditions
Analyzing interaction patterns with hypoxia-induced isoforms of nuclear-encoded subunits
Research shows that in vertebrates, COX IV isoform 2 is specifically expressed in oxygen exchange tissues and is induced during hypoxia
Functional characterization under varying oxygen conditions:
Species-specific adaptations:
Comparing MT-CO2 from species adapted to different oxygen environments
For example, fish show COX IV isoform 2 expression patterns in gills similar to mammals in lungs, suggesting ancient adaptation mechanisms
Examining whether MT-CO2 variants show co-adaptations with hypoxia-related subunit isoforms
Experimental manipulation:
Using recombinant MT-CO2 in reconstitution experiments with different combinations of nuclear-encoded subunits
Site-directed mutagenesis to test hypotheses about specific residues important for function under hypoxic conditions
This research area is particularly significant for understanding how organisms adapt to varying oxygen environments and could have implications for understanding hypoxia-related pathologies .
Recombinant MT-CO2 provides a powerful tool for investigating nuclear-mitochondrial genetic incompatibilities:
Reconstitution experiments:
Combining recombinant MT-CO2 from one species with nuclear-encoded subunits from another
Measuring functional parameters to identify incompatibilities
This approach can help understand why interpopulation hybrids between central and northern California populations of Tigriopus californicus show functional and fitness consequences
Evolutionary mismatch modeling:
Using recombinant proteins to test theoretical models of nuclear-mitochondrial co-evolution
Examining how specific substitutions affect interaction interfaces
Studies have shown that approximately 4% of the sites in MT-CO2 appear to evolve under relaxed selective constraint, which may contribute to incompatibilities
Structure-function analyses:
Disease model applications:
Understanding how mismatches between nuclear and mitochondrial genomes contribute to disease states
Exploring how evolutionary patterns inform susceptibility to mitochondrial disorders
The unique pattern of co-evolution between nuclear and mitochondrial genomes in primates may provide insights into human-specific vulnerabilities
This research has broad implications for understanding speciation, adaptation, and mitochondrial disease mechanisms .
Researchers face several methodological challenges when working with recombinant MT-CO2:
Expression system limitations:
Purification considerations:
Stability concerns:
Functional verification:
Verifying that the recombinant protein maintains native activity requires specialized assays
Reconstitution with other components of Complex IV may be necessary to assess function
Comparison with native protein is recommended to validate experimental results
These challenges highlight the importance of carefully optimized protocols when working with recombinant MT-CO2 in research applications.
Ensuring the quality and activity of recombinant MT-CO2 requires a multi-faceted approach:
Purity assessment:
Structural integrity:
Circular dichroism to assess secondary structure
Thermal stability assays to determine protein folding quality
Spectroscopic analysis of copper centers to confirm proper metal incorporation
Functional verification:
Electron transfer activity using reduced cytochrome c as substrate
Oxygen consumption measurements when incorporated into membrane systems
Reconstitution with other subunits to form a functional complex
Comparative analysis:
Side-by-side comparison with native enzyme when possible
Benchmarking against reference standards or previous preparations
Species-specific considerations when comparing with homologs from other organisms
A comprehensive quality control regimen should incorporate multiple complementary methods to ensure that the recombinant MT-CO2 is suitable for the intended research applications.