Recombinant Callimico goeldii Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Callimico goeldii Cytochrome c oxidase subunit 2 (MT-CO2) is a transmembrane protein that is a subunit of cytochrome c oxidase, an enzyme complex essential for the electron transport chain in mitochondria . Cytochrome c oxidase, also known as Complex IV, plays a vital role in cellular respiration by catalyzing the transfer of electrons to oxygen, generating water, and contributing to the proton gradient that drives ATP synthesis . Callimico goeldii is Goeldi's marmoset.

Basic Information

  • Product Code: CSB-CF015073CYI

  • Uniprot No.: P50661

  • Product Type: Transmembrane Protein

  • Immunogen Species: Callimico goeldii (Goeldi's marmoset)

  • Source: In vitro E. coli expression system

  • Target Names: MT-CO2

  • Protein Names: Cytochrome c oxidase subunit 2

  • Alternative Names: Cytochrome c oxidase polypeptide II

  • Expression Region: 1-216

  • Tag Info: N-terminal 10xHis-tagged

  • Protein Length: Full length protein

Sequence

The amino acid sequence of Recombinant Callimico goeldii Cytochrome c oxidase subunit 2 (MT-CO2) is :
LGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMI
WT
ILPAVILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYI
TPTY
FLEPGEFRLLEVDNRTTLPMEADIRVLISSQDVLHSWAVPALGVKTDAIPGRLN
QAMLTS TRPGLYYGQCSEICGSNHSFMPIVLEFIYFQDFEVW

Biological Role and Significance

Cytochrome c oxidase (Complex IV) is the terminal enzyme of the mitochondrial respiratory chain . It catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing it to water. This process is coupled with the translocation of protons across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis by ATP synthase .

Subunit 2 (MT-CO2) is a core subunit of the cytochrome c oxidase complex and is directly involved in the electron transfer process . It contains the binding site for cytochrome c and plays a crucial role in the redox reactions of the enzyme.

5.1. Importance of Cytochrome c Oxidase

Cytochrome c oxidase is essential for energy production in eukaryotic cells . Defects in cytochrome c oxidase activity have been implicated in various human diseases, including mitochondrial myopathies, neurodegenerative disorders, and aging .

5.2. Conservation and Evolution

Cytochrome c oxidase subunit 2 is highly conserved across different species, reflecting its critical function . Comparative studies of MT-CO2 sequences in different organisms can provide insights into the evolution of the respiratory chain and the adaptation of organisms to different environments.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Callimico goeldii (Goeldi's marmoset)
Target Names
Target Protein Sequence
LGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMIWT ILPAVILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYITPTY FLEPGEFRLLEVDNRTTLPMEADIRVLISSQDVLHSWAVPALGVKTDAIPGRLNQAMLTS TRPGLYYGQCSEICGSNHSFMPIVLEFIYFQDFEVW
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site—a binuclear center (BNC) comprising heme a3 and copper B (CuB) in subunit 1. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant MT-CO2 from Callimico goeldii typically produced?

Recombinant Callimico goeldii MT-CO2 is typically produced using an E. coli expression system. The full-length protein (residues 1-216) is expressed with an N-terminal His-tag to facilitate purification . The production process involves:

  • Cloning the MT-CO2 gene into an expression vector

  • Transformation into E. coli

  • Induction of protein expression

  • Cell lysis and extraction

  • Affinity purification using the His-tag

  • Further purification steps to achieve >90% purity as determined by SDS-PAGE

  • Lyophilization or storage in buffer with stabilizing agents

The resulting recombinant protein has a molecular weight of approximately 24.8 kDa and contains the complete functional domains of the native protein .

What are the optimal storage conditions for recombinant MT-CO2?

For optimal stability and activity, recombinant MT-CO2 should be stored according to the following guidelines:

Storage ConditionRecommendation
Long-term storage-20°C or -80°C as lyophilized powder or in storage buffer
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDissolve in deionized sterile water to 0.1-1.0 mg/mL
Stabilizing agentAdd glycerol to 5-50% final concentration for aliquots

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom .

How does the structure of MT-CO2 from Callimico goeldii compare to other species?

Comparing the MT-CO2 from Callimico goeldii (216 amino acids) with that from Arvicanthis somalicus (227 amino acids) reveals interesting structural differences:

FeatureCallimico goeldii MT-CO2Arvicanthis somalicus MT-CO2
Length216 amino acids 227 amino acids
UniProt IDP50661 Q38S26
Sequence homologyReferenceDiffers in length and composition

Despite these differences, the core functional domains related to electron transfer are generally conserved across species, reflecting the essential role of this protein in cellular respiration . In studies of other species, interpopulation divergence at the COII locus can be significant - in the marine copepod Tigriopus californicus, nearly 20% divergence at the nucleotide level was observed, including 38 nonsynonymous substitutions .

What experimental techniques are most effective for studying MT-CO2 function?

Several methodological approaches can be employed to study MT-CO2 function:

  • Biochemical assays:

    • Spectrophotometric measurement of cytochrome c oxidation rates

    • Polarographic determination of oxygen consumption

    • ATP production assays to assess coupling efficiency

  • Structural biology techniques:

    • X-ray crystallography to determine three-dimensional structure

    • Cryo-electron microscopy for complex visualization

    • Spectroscopic methods to analyze the copper centers

  • Molecular biology approaches:

    • Site-directed mutagenesis to study the role of specific residues

    • Expression of recombinant protein in different systems

    • Reconstitution experiments with purified components

  • Evolutionary analyses:

    • Comparative genomics to identify conserved functional domains

    • Phylogenetic analyses to trace evolutionary changes

    • Selection pressure analyses to identify adaptively evolving sites

When designing experiments, researchers should consider that MT-CO2 interacts with nuclear-encoded subunits that may have tissue-specific isoforms, potentially affecting functional outcomes .

How does MT-CO2 interact with other components of the cytochrome c oxidase complex?

MT-CO2 forms critical interactions with both mitochondrial-encoded and nuclear-encoded subunits of the cytochrome c oxidase complex, as well as with its electron donor, cytochrome c:

  • Interactions with cytochrome c:

    • MT-CO2 contains the primary binding site for cytochrome c

    • The CuA center in MT-CO2 accepts electrons from reduced cytochrome c

    • Studies in primates have identified 57 residues in COX that bind cytochrome c, with 27 of these positions showing replacements in the anthropoid lineage

  • Interactions with MT-CO1:

    • MT-CO2 transfers electrons to the binuclear center in MT-CO1

    • This interaction is essential for the catalytic reduction of oxygen to water

  • Assembly interactions:

    • MT-CO2 is incorporated into the complex through a stepwise assembly pathway

    • Several assembly factors ensure proper integration of MT-CO2 into the complex

Research indicates that despite the high conservation of catalytic function, there is evidence for co-evolution between MT-CO2 and its interacting partners, particularly in primate lineages where 11 charge-bearing residues involved in binding cytochrome c have been replaced with uncharged residues .

How has MT-CO2 evolved among different primate lineages, and what does this suggest about selective pressures?

Evolutionary analyses of MT-CO2 in primates reveal fascinating patterns of selection and adaptation:

  • Accelerated evolution in anthropoid primates:

    • Nine of the thirteen COX subunits, including MT-CO2, show accelerated amino acid replacement rates in anthropoid primates

    • This suggests distinct selective pressures in this lineage, potentially related to increased metabolic demands

  • Codon-specific selection patterns:

    • Studies in Tigriopus californicus revealed that the majority of codons in MT-CO2 are under strong purifying selection (ω << 1)

    • Approximately 4% of sites appear to evolve under relaxed selective constraint (ω = 1)

    • Some sites may have experienced positive selection within specific lineages

  • Co-evolution with nuclear genome:

    • There is evidence for co-evolution between MT-CO2 and nuclear-encoded subunits of COX

    • This pattern reflects the need to maintain compatible interactions between proteins encoded by two different genomes

    • The high degree of interaction between MT-CO2 and nuclear-encoded components suggests that some codons may be under positive selection to compensate for amino acid substitutions in other subunits

This evolutionary pattern has been described as a "domestication scenario" where the nuclear genome increasingly controls the ancestral activity of MT-CO2, emphasizing the importance of regulatory adaptation in mitochondrial function evolution .

What methodological approaches can be used to study the role of MT-CO2 in hypoxia adaptation?

Studying the role of MT-CO2 in hypoxia adaptation requires sophisticated methodological approaches:

  • Comparative expression analysis:

    • Quantifying MT-CO2 expression levels under normoxic versus hypoxic conditions

    • Analyzing interaction patterns with hypoxia-induced isoforms of nuclear-encoded subunits

    • Research shows that in vertebrates, COX IV isoform 2 is specifically expressed in oxygen exchange tissues and is induced during hypoxia

  • Functional characterization under varying oxygen conditions:

    • Measuring enzyme kinetics and oxygen affinity of reconstituted complexes containing MT-CO2

    • Assessing ROS production, as cells expressing hypoxia-specific isoforms produce fewer free radicals

    • Analyzing proton pumping efficiency under different oxygen tensions

  • Species-specific adaptations:

    • Comparing MT-CO2 from species adapted to different oxygen environments

    • For example, fish show COX IV isoform 2 expression patterns in gills similar to mammals in lungs, suggesting ancient adaptation mechanisms

    • Examining whether MT-CO2 variants show co-adaptations with hypoxia-related subunit isoforms

  • Experimental manipulation:

    • Using recombinant MT-CO2 in reconstitution experiments with different combinations of nuclear-encoded subunits

    • Site-directed mutagenesis to test hypotheses about specific residues important for function under hypoxic conditions

This research area is particularly significant for understanding how organisms adapt to varying oxygen environments and could have implications for understanding hypoxia-related pathologies .

How can recombinant MT-CO2 be used to investigate nuclear-mitochondrial genetic incompatibilities?

Recombinant MT-CO2 provides a powerful tool for investigating nuclear-mitochondrial genetic incompatibilities:

  • Reconstitution experiments:

    • Combining recombinant MT-CO2 from one species with nuclear-encoded subunits from another

    • Measuring functional parameters to identify incompatibilities

    • This approach can help understand why interpopulation hybrids between central and northern California populations of Tigriopus californicus show functional and fitness consequences

  • Evolutionary mismatch modeling:

    • Using recombinant proteins to test theoretical models of nuclear-mitochondrial co-evolution

    • Examining how specific substitutions affect interaction interfaces

    • Studies have shown that approximately 4% of the sites in MT-CO2 appear to evolve under relaxed selective constraint, which may contribute to incompatibilities

  • Structure-function analyses:

    • Determining how structural variations affect functional interactions

    • Identifying critical residues at protein interfaces

    • The binuclear copper A center and its surrounding residues are particularly important regions to investigate

  • Disease model applications:

    • Understanding how mismatches between nuclear and mitochondrial genomes contribute to disease states

    • Exploring how evolutionary patterns inform susceptibility to mitochondrial disorders

    • The unique pattern of co-evolution between nuclear and mitochondrial genomes in primates may provide insights into human-specific vulnerabilities

This research has broad implications for understanding speciation, adaptation, and mitochondrial disease mechanisms .

What are the challenges in expressing and purifying functional recombinant MT-CO2?

Researchers face several methodological challenges when working with recombinant MT-CO2:

  • Expression system limitations:

    • E. coli expression systems may not reproduce all post-translational modifications

    • The protein contains transmembrane domains that can cause folding challenges

    • Metal incorporation (copper) may be incomplete or incorrect without supplementation

  • Purification considerations:

    • The presence of hydrophobic regions requires careful detergent selection

    • Maintaining the native conformation during purification is essential for functional studies

    • The His-tag, while useful for purification, may affect certain functional assays or structural analyses

  • Stability concerns:

    • The recommended storage conditions (Tris/PBS-based buffer with 6% Trehalose or 50% glycerol) indicate potential stability issues

    • Working aliquots should be stored at 4°C for no more than one week

    • For extended storage, the protein should be stored at -20°C/-80°C with glycerol as a cryoprotectant

  • Functional verification:

    • Verifying that the recombinant protein maintains native activity requires specialized assays

    • Reconstitution with other components of Complex IV may be necessary to assess function

    • Comparison with native protein is recommended to validate experimental results

These challenges highlight the importance of carefully optimized protocols when working with recombinant MT-CO2 in research applications.

How can researchers verify the quality and activity of recombinant MT-CO2 preparations?

Ensuring the quality and activity of recombinant MT-CO2 requires a multi-faceted approach:

  • Purity assessment:

    • SDS-PAGE analysis (>90% purity is typically achieved in commercial preparations)

    • Mass spectrometry to confirm protein identity and detect potential contaminants

    • Absorbance ratio (A260/A280) to detect nucleic acid contamination

  • Structural integrity:

    • Circular dichroism to assess secondary structure

    • Thermal stability assays to determine protein folding quality

    • Spectroscopic analysis of copper centers to confirm proper metal incorporation

  • Functional verification:

    • Electron transfer activity using reduced cytochrome c as substrate

    • Oxygen consumption measurements when incorporated into membrane systems

    • Reconstitution with other subunits to form a functional complex

  • Comparative analysis:

    • Side-by-side comparison with native enzyme when possible

    • Benchmarking against reference standards or previous preparations

    • Species-specific considerations when comparing with homologs from other organisms

A comprehensive quality control regimen should incorporate multiple complementary methods to ensure that the recombinant MT-CO2 is suitable for the intended research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.