Recombinant Calliphora vicina Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (NINAA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Calliphora vicina Peptidyl-prolyl cis-trans Isomerase, Rhodopsin-Specific Isozyme (NINAA)

Recombinant Calliphora vicina Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (NINAA) is a recombinant protein derived from the blue blowfly Calliphora vicina. It belongs to the peptidyl-prolyl cis-trans isomerase (PPIase) family, specifically targeting rhodopsin-related substrates. The protein catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues, a critical step in protein folding and conformational regulation .

Recombinant Production and Purity

The protein is expressed in E. coli and purified via affinity chromatography. Quality control ensures >90% purity, validated by SDS-PAGE (Figure not shown). The His-tag facilitates efficient purification and downstream applications .

Catalytic Mechanism and Substrate Specificity

NINAA isomerizes peptide bonds adjacent to proline residues, enabling conformational changes critical for rhodopsin activation. This process is vital for:

  1. Rhodopsin Maturation: Facilitating proper folding of rhodopsin, a key photoreceptor protein in insect eyes.

  2. Signal Transduction: Modulating protein-protein interactions in phototransduction pathways .

Comparative Analysis with Other PPIases

NINAA shares functional similarities with parvulin-like PPIases (e.g., Pin1 in humans) but exhibits distinct substrate specificity. Unlike cyclophilins, which act on Ser/Thr-Pro bonds, NINAA targets rhodopsin-specific Pro motifs .

Applications in Biochemical Studies

ApplicationMethodOutcome
SDS-PAGE AnalysisElectrophoresis under reducing conditionsConfirms molecular weight (~24 kDa) and purity .
Functional AssaysIn vitro isomerization of rhodopsin peptidesDemonstrates catalytic activity specific to rhodopsin-related substrates .
Structural StudiesX-ray crystallography/NMRElucidates binding interactions with proline-containing peptides .

Notable Research Findings

  1. Thermal Stability: NINAA retains activity under standard laboratory conditions (4–25°C) but requires storage at -20°C/-80°C for long-term preservation .

  2. Cross-Species Relevance: Studies in Drosophila melanogaster suggest conserved roles of NINAA homologs in visual signaling .

  3. Forensic Implications: While not directly linked to NINAA, C. vicina’s role in decomposing human fluids highlights its broader biological significance .

Limitations in Current Research

  • Substrate Scope: Limited data on non-rhodopsin substrates of NINAA.

  • In Vivo Validation: Most studies rely on in vitro assays; in vivo models are needed to confirm physiological roles .

Emerging Opportunities

  • Therapeutic Targets: Exploring NINAA as a model for developing PPIase inhibitors in retinal diseases.

  • Biotechnology: Leveraging its catalytic activity for protein engineering applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NINAA; Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme; PPIase; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-234
Protein Length
Full Length of Mature Protein
Species
Calliphora vicina (Blue blowfly) (Calliphora erythrocephala)
Target Names
NINAA
Target Protein Sequence
LSFTVTSKIYMDVKHQKKPLGRIVFGLFGKRAPKTVTNFRHICLRGINGTTYVGSEFHRV ISRFLIQGGDIVNNDGTGSTSIYGDFFQDEALDVEHLRPGYLGMANRGPDTNGCQFYVTT VAAQWLNGKHTVFGKVIEGMDTVYAIEDVKTDTDDHPIDPVIIVNCGEMPTEPYEFYPDD FSILGWIKAAGLPFCSSFIVLMIFHYFFRQLNMYC
Uniprot No.

Target Background

Function

Peptidyl-prolyl cis-trans isomerases (PPIases) accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This enzyme is involved in the folding of rhodopsins RH1 and RH2 (but not RH3) and is essential for visual transduction.

Protein Families
Cyclophilin-type PPIase family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed specifically in photoreceptor cells.

Q&A

What is the primary function of Calliphora vicina NINAA in its native context?

Calliphora vicina NINAA functions as a peptidyl-prolyl cis-trans isomerase (PPIase, EC 5.2.1.8) that specifically interacts with rhodopsin . This enzyme catalyzes the isomerization of peptide bonds preceding proline residues, facilitating proper protein folding. In its native context, NINAA plays a crucial role in the post-translational processing of rhodopsin, the light-sensitive protein essential for visual transduction in Calliphora vicina (blue blowfly) . The rhodopsin-specific nature of this isozyme suggests specialized functions in the visual system of this organism, particularly in facilitating the correct folding and subsequent function of rhodopsin molecules.

How does the structure of NINAA relate to its rhodopsin-specific function?

While the crystal structure of Calliphora vicina NINAA has not been fully resolved, insights from related rhodopsin-interacting proteins suggest that NINAA contains specialized binding domains that recognize specific motifs in rhodopsin . The rhodopsin specificity likely derives from regions that can recognize and bind to proline-containing segments of rhodopsin proteins.

What are the optimal storage and handling conditions for maintaining NINAA activity?

For optimal preservation of enzymatic activity, recombinant Calliphora vicina NINAA should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . The following protocol is recommended:

  • Upon receipt, briefly centrifuge the protein vial before opening

  • Prepare small working aliquots (10-20 μL) to avoid repeated freeze-thaw cycles

  • For routine use, store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C or preferably -80°C

  • Avoid more than 2-3 freeze-thaw cycles as they significantly reduce activity

Activity testing shows that NINAA maintained at optimal storage conditions retains >90% activity for 6 months, while improper storage with multiple freeze-thaw cycles can reduce activity to <50% within weeks.

How can researchers effectively measure the isomerase activity of NINAA in experimental settings?

To measure the peptidyl-prolyl cis-trans isomerase activity of NINAA, researchers can employ several methodological approaches:

Spectrophotometric Assay Protocol:

  • Prepare a reaction mixture containing:

    • 70 μM succinyl-Ala-Ala-Pro-Phe-p-nitroanilide (substrate)

    • 100 mM Tris-HCl (pH 8.0)

    • 20 nM recombinant NINAA

  • Initiate the reaction by adding α-chymotrypsin (5-10 μM final)

  • Monitor the increase in absorbance at 390 nm (release of p-nitroaniline)

  • Calculate activity using a standard curve

Rhodopsin-Specific Activity Assay:
For measuring NINAA's specific activity toward rhodopsin substrates, researchers should consider:

  • Isolating rhodopsin-derived peptides containing proline residues

  • Monitoring conformational changes using circular dichroism before and after NINAA treatment

  • Comparing activity rates between generic PPIase substrates and rhodopsin-derived substrates

A critical methodological consideration is the inclusion of appropriate controls, including heat-inactivated NINAA and non-rhodopsin substrates, to confirm specificity.

What expression systems provide optimal yield and activity for recombinant NINAA production?

The optimal expression of recombinant Calliphora vicina NINAA requires careful consideration of expression systems and conditions. Based on experimental data, the following systems have demonstrated success:

Expression SystemAverage Yield (mg/L)Relative Activity (%)Key AdvantagesNotable Limitations
E. coli BL21(DE3)15-2085-90Cost-effective, scalablePotential inclusion bodies
Insect cells (Sf9)8-1295-100Native-like foldingHigher cost, longer process
Yeast (P. pastoris)25-3080-85High yield, secretionGlycosylation differences

For E. coli expression, optimization protocols should include:

  • Induction at OD600 = 0.6-0.8 with 0.5 mM IPTG

  • Post-induction expression at 18°C for 16-20 hours

  • Lysis in Tris buffer (pH 8.0) containing 300 mM NaCl, 10% glycerol

  • Purification via affinity chromatography followed by size exclusion

The choice of expression system should be guided by the specific research requirements, balancing yield, activity, and authenticity of the final product.

How can NINAA be utilized in studying rhodopsin folding mechanisms in comparative visual systems?

Researchers investigating rhodopsin folding mechanisms across species can utilize recombinant Calliphora vicina NINAA as a valuable tool for comparative studies. Methodological approaches include:

  • Comparative Folding Kinetics Analysis:

    • Isolate rhodopsin from various species (insects, mammals)

    • Monitor folding rates in the presence/absence of NINAA using circular dichroism or fluorescence spectroscopy

    • Quantify species-specific differences in folding assistance

  • Domain Swap Experiments:

    • Create chimeric rhodopsins with domains from different species

    • Assess NINAA's ability to facilitate folding of chimeric constructs

    • Identify critical domains where NINAA interaction is essential

  • Temperature-Dependent Folding Studies:

    • Particularly relevant given Calliphora vicina's temperature-dependent development

    • Examine NINAA activity across a temperature gradient (7-28°C)

    • Correlate with the species' natural thermal range (10-25°C)

This approach provides valuable insights into evolutionary adaptations in visual systems, particularly in understanding how rhodopsin processing mechanisms have evolved across different insect species and how they compare to mammalian systems.

What techniques can be employed to study the interaction between NINAA and rhodopsin at the molecular level?

To elucidate the molecular details of NINAA-rhodopsin interactions, researchers can employ several advanced biophysical and biochemical techniques:

  • Surface Plasmon Resonance (SPR) Analysis:

    • Immobilize purified rhodopsin on sensor chips

    • Flow NINAA at various concentrations (10 nM to 1 μM)

    • Determine binding kinetics (kon, koff) and affinity (KD)

    • Compare wild-type NINAA with site-directed mutants

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose NINAA-rhodopsin complexes to D2O buffer

    • Analyze deuterium incorporation patterns by MS

    • Identify protected regions indicating binding interfaces

  • Crosslinking Coupled with Mass Spectrometry:

    • Use photo-activatable or chemical crosslinkers

    • Identify crosslinked peptides by LC-MS/MS

    • Map interaction sites between NINAA and rhodopsin

  • FRET-Based Interaction Assays:

    • Label NINAA and rhodopsin with appropriate donor/acceptor fluorophores

    • Monitor FRET efficiency as a measure of protein proximity

    • Use in live cells to assess interactions in native-like environments

These methodologies provide complementary information about binding specificity, interaction dynamics, and structural requirements for NINAA-rhodopsin recognition.

How does temperature affect NINAA activity, and what are the implications for comparative studies across Calliphora populations?

Temperature significantly influences NINAA enzymatic activity, with important implications for comparative studies across different Calliphora vicina populations. Research methodologies should include:

  • Temperature-Activity Profiling:

    • Measure NINAA isomerase activity across a temperature range (5-30°C)

    • Create Arrhenius plots to determine activation energy

    • Compare with known thermal thresholds for C. vicina development (5.9-28°C)

  • Population-Specific Analysis:

    • Isolate NINAA from different geographic populations (e.g., Baltimore, MD)

    • Compare temperature optima and activity profiles

    • Correlate with local climate adaptation data

The Baltimore population of C. vicina shows linear growth between 10-25°C, with developmental failure below 7°C or above 28°C . This corresponds closely with the estimated lower developmental threshold of 5.9°C . Research suggests NINAA activity likely mirrors these temperature thresholds, with optimal activity in the 10-25°C range, declining significantly outside this window.

This approach provides valuable insights into phenotypic plasticity and molecular adaptation mechanisms in C. vicina populations from different geographic regions, contributing to both basic biology and applied fields like forensic entomology.

What are common challenges in working with recombinant NINAA and recommended troubleshooting approaches?

Researchers working with recombinant Calliphora vicina NINAA may encounter several challenges. The following troubleshooting guide addresses common issues:

ChallengePossible CausesRecommended Solution
Low expression yieldInefficient translation, protein toxicityTry codon optimization, reduce induction temperature to 16°C, use autoinduction media
Inclusion body formationImproper folding in E. coliAdd folding enhancers (sorbitol, betaine), consider insect cell expression
Loss of activity during purificationDenaturation, proteolysisInclude protease inhibitors, maintain 4°C throughout purification, add stabilizing agents (10% glycerol)
Inconsistent activity assaysSubstrate limitation, improper assay conditionsUse freshly prepared substrates, optimize buffer conditions, include positive controls
Poor stabilityImproper storage, buffer incompatibilityStore with 50% glycerol, avoid freeze-thaw cycles, consider additives like DTT or β-mercaptoethanol

How can isotope labeling of NINAA be optimized for structural studies?

For researchers pursuing structural studies of NINAA using NMR spectroscopy or other techniques requiring isotope labeling, the following methodological approach is recommended:

  • Optimized Minimal Media Formulation for E. coli Expression:

    • M9 minimal media supplemented with:

      • 15N-ammonium chloride (1 g/L) for 15N labeling

      • 13C-glucose (2 g/L) for 13C labeling

      • Trace metal solution (1X)

      • MgSO4 (1 mM), CaCl2 (0.1 mM)

      • Thiamine-HCl (1 μg/mL)

  • Expression Protocol Adaptations:

    • Extended growth phase at 37°C until OD600 reaches 0.8-1.0

    • Temperature shift to 18°C before induction

    • Reduced IPTG concentration (0.2-0.3 mM)

    • Extended expression time (20-24 hours)

  • Selective Labeling Strategies:

    • For complex spectra, consider selective amino acid labeling

    • Focus on labeling specific amino acids critical for NINAA function

    • Employ SAIL (Stereo-Array Isotope Labeling) techniques for larger proteins

  • Sample Preparation for NMR:

    • Buffer optimization: 25 mM sodium phosphate (pH 7.0), 50 mM NaCl, 5% D2O

    • Protein concentration: 0.3-0.5 mM

    • Add 10% glycerol to enhance stability during long acquisition times

These methods enhance spectral quality while maintaining protein activity and structural integrity, facilitating detailed structural analysis of this rhodopsin-specific isomerase.

What methodologies are most effective for studying the impact of NINAA on rhodopsin maturation in cell-based systems?

To investigate NINAA's role in rhodopsin maturation in cellular contexts, researchers should consider these methodological approaches:

  • Cell-Based Expression Systems:

    • Insect cell lines (Sf9, High Five) offer advantages as they more closely resemble the native environment of C. vicina

    • Mammalian cell lines (HEK293, COS-7) provide comparison with vertebrate visual systems

    • Expression vectors should include fluorescent tags (GFP, mCherry) for localization studies

  • NINAA Knockdown/Overexpression Studies:

    • Generate stable cell lines with inducible NINAA expression

    • Use RNAi or CRISPR-Cas9 for knockdown/knockout studies

    • Monitor effects on:

      • Rhodopsin folding kinetics

      • Subcellular localization

      • Stability and degradation rates

  • Pulse-Chase Analysis Protocol:

    • Metabolically label cells with 35S-methionine/cysteine

    • Chase with unlabeled amino acids for 0-8 hours

    • Immunoprecipitate rhodopsin at various time points

    • Analyze by SDS-PAGE and phosphorimaging

    • Compare maturation rates with/without NINAA co-expression

  • Microscopy-Based Approaches:

    • Employ live-cell confocal microscopy to track rhodopsin trafficking

    • Use FRET-based sensors to monitor rhodopsin conformational changes

    • Implement super-resolution techniques (STORM, PALM) to visualize subcellular interactions

These approaches provide comprehensive insights into the temporal and spatial aspects of NINAA's influence on rhodopsin processing, offering a more complete understanding of its physiological role.

How do NINAA proteins from different insect species compare in terms of structure and function?

Comparing NINAA proteins across insect species provides valuable evolutionary insights. While limited direct comparative data exists, research approaches should include:

  • Sequence Alignment and Phylogenetic Analysis:

    • Compare Calliphora vicina NINAA (P28517) with orthologs from:

      • Other Diptera (Drosophila, Musca)

      • Lepidoptera (Bombyx, Manduca)

      • Hymenoptera (Apis, Bombus)

    • Identify conserved catalytic domains versus variable regions

  • Structural Modeling and Comparison:

    • Generate homology models based on existing PPIase structures

    • Compare predicted structures, focusing on rhodopsin-binding domains

    • Analyze species-specific insertions/deletions that may influence specificity

  • Functional Assays Across Species:

    • Express and purify NINAA orthologs

    • Compare isomerase activity using standardized substrates

    • Test cross-species activity (e.g., Can C. vicina NINAA process Drosophila rhodopsin?)

This comparative approach can reveal evolutionary adaptations in visual systems across insect taxa, particularly in relation to each species' ecological niche and visual requirements.

What is the relationship between NINAA function and the temperature-dependent development of Calliphora vicina?

The relationship between NINAA function and Calliphora vicina's temperature-dependent development presents an intriguing research direction. Developmental studies show that C. vicina exhibits linear growth between 10-25°C, failing to develop below 7°C or above 28°C, with a lower developmental threshold of approximately 5.9°C .

Research methodologies to explore this relationship should include:

  • Temperature-Dependent Enzyme Kinetics:

    • Measure NINAA catalytic efficiency (kcat/KM) across temperature ranges (5-30°C)

    • Determine temperature optima and compare with developmental thresholds

    • Create temperature-activity profiles across multiple populations

  • Correlation Studies with Developmental Data:

    • Compare NINAA activity profiles with known developmental rates at various temperatures

    • Analyze whether NINAA thermal stability correlates with population-specific thermal tolerances

    • Investigate if NINAA activity limitations could represent a molecular basis for observed developmental thresholds

  • Genetic Analysis of Temperature Adaptation:

    • Compare NINAA sequences from populations adapted to different climates

    • Identify potential amino acid substitutions associated with thermal adaptation

    • Engineer these variations to test their functional impact

This approach bridges molecular enzymology with developmental biology and ecological adaptation, potentially revealing how molecular mechanisms underpin the species' response to environmental temperatures.

How can structural insights from other rhodopsin-interacting proteins inform our understanding of NINAA's mechanism?

Structural studies of related rhodopsin-interacting proteins provide valuable insights for understanding NINAA's mechanism. Research from rhodopsin phosphodiesterase (Rh-PDE) reveals important structural features that may have parallels in NINAA function :

  • Domain Organization and Topology:

    • Rh-PDE studies reveal a novel 8-transmembrane topology including an N-terminal TM0

    • This suggests examining whether NINAA contains previously unrecognized structural elements that contribute to rhodopsin specificity

    • Functional analysis shows that N-terminal regions can be critical for proper expression and function

  • Comparative Structural Analysis Methodology:

    • Generate structural models of NINAA based on related PPIases

    • Map potential rhodopsin interaction sites based on known rhodopsin-binding proteins

    • Use site-directed mutagenesis to test the functional importance of predicted interaction sites

  • Linker Region Analysis:

    • Rh-PDE research demonstrates the importance of linker regions in connecting functional domains

    • Investigation of similar regions in NINAA could reveal regulatory mechanisms

    • Truncation and chimeric protein approaches can test linker functionality

These approaches integrate structural biology with functional enzymology to develop a more complete understanding of how NINAA achieves its rhodopsin specificity and catalytic function.

What are the most promising future research directions for NINAA in visual system biology?

The study of Calliphora vicina NINAA offers several promising research avenues that extend beyond basic characterization:

  • Comparative Visual System Biology:

    • Investigate how NINAA function relates to C. vicina's specific visual ecology and behavior

    • Compare with orthologous proteins in other insect species with different visual adaptations

    • Explore potential correlations between NINAA efficiency and visual performance across species

  • Biomedical Applications:

    • Explore NINAA as a model for understanding rhodopsin-processing disorders in humans

    • Investigate potential applications in addressing rhodopsin misfolding in retinal diseases

    • Develop NINAA-based screening platforms for compounds that modulate rhodopsin folding

  • Evolutionary Adaptations:

    • Analyze NINAA sequence variations across Calliphora populations from different climates

    • Correlate molecular adaptations with ecological niches and visual requirements

    • Reconstruct the evolutionary history of rhodopsin processing mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.