Recombinant Callithrix geoffroyi Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

General Structure and Function of MC1R

The Melanocortin-1 Receptor (MC1R) belongs to the G protein-coupled receptor superfamily primarily expressed in melanocytes, the specialized cells responsible for melanin production. MC1R functions as a key regulator of pigmentation in mammals by controlling the synthesis of different melanin types (eumelanin and pheomelanin). This transmembrane receptor responds to melanocortin peptides, particularly α-melanocyte-stimulating hormone (α-MSH), triggering intracellular signaling cascades that ultimately determine skin and hair color .

The MC1R gene is highly polymorphic in many species, with variations significantly influencing pigmentation phenotypes. In humans, mutations in the MC1R gene account for red hair and light skin in approximately 1-2% of the population . Beyond its role in pigmentation, research has revealed MC1R's involvement in various cellular processes including DNA repair, cell cycle regulation, and apoptosis, highlighting its multifunctional nature in cellular biology .

Callithrix geoffroyi MC1R Characteristics

Callithrix geoffroyi (Geoffroy's marmoset) is a New World primate native to eastern Brazil. The MC1R protein from this species has become an important subject of study for understanding comparative melanocortin receptor biology across primate lineages. The recombinant version of this protein maintains the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors while exhibiting species-specific variations in its amino acid sequence .

The full-length Callithrix geoffroyi MC1R protein consists of 344 amino acids, with its complete sequence characterized and available for research applications . The recombinant version typically includes a histidine tag (His-tag) to facilitate purification and detection in experimental settings. This modification, while not altering the protein's core functionality, enhances its utility for biochemical and structural studies .

Expression Systems and Purification Methods

Recombinant Callithrix geoffroyi MC1R protein is primarily produced using prokaryotic expression systems, with Escherichia coli being the most commonly employed host organism . This bacterial expression system offers advantages including high yield, cost-effectiveness, and well-established purification protocols. The recombinant protein typically includes an N-terminal His-tag, which facilitates purification through affinity chromatography .

Table 1: Production Specifications for Recombinant Callithrix geoffroyi MC1R

ParameterSpecificationNotes
Expression SystemE. coliStandard prokaryotic host
Protein Length344 amino acids (Full Length)Complete protein sequence
TagHis (N-terminal)For purification and detection
Purity>90%As determined by SDS-PAGE
FormLyophilized powderStandard commercial form
Molecular Weight~38 kDaIncluding His-tag

MC1R Variants Across Mammalian Species

Comparative analysis of MC1R across species provides valuable insights into evolutionary adaptations related to pigmentation. The mouse MC1R protein consists of 315 amino acids, somewhat shorter than the 344-amino acid Callithrix geoffroyi version, while maintaining the essential functional domains . These differences reflect evolutionary divergence and adaptation to species-specific requirements for pigmentation regulation.

Table 2: Comparison of MC1R Characteristics Across Species

SpeciesProtein LengthExpression SystemKey FeaturesReferences
Callithrix geoffroyi344 aaE. coliHis-tagged, full-length transmembrane protein
Mouse (Mus musculus)315 aaHEK293His-tagged, implicated in coat color variation
HumanVariableMultiple systemsHighly polymorphic, linked to red hair and melanoma risk

The conservation of key functional domains across these species highlights the fundamental importance of MC1R in vertebrate biology, while variable regions suggest potential sites of adaptive evolution. These differences may influence ligand binding specificity, signaling efficiency, and ultimately the phenotypic expression of pigmentation traits .

Functional Implications of MC1R Variations

Research on human MC1R variants has revealed significant functional implications beyond pigmentation, particularly regarding cancer susceptibility. Studies have demonstrated that certain MC1R mutations (MC1R-RHC) can promote the PI3K/Akt signaling pathway when exposed to UV radiation, potentially explaining the increased melanoma risk observed in individuals with these variants .

The recombinant Callithrix geoffroyi MC1R provides an opportunity to investigate whether similar mechanisms operate in non-human primates. Comparative functional studies could reveal how species-specific variations in MC1R influence not only pigmentation but also cellular processes relevant to health and disease, including DNA repair, cell cycle regulation, and apoptosis .

Recent research suggests that MC1R regulates expression of the MITF transcription factor, which in turn affects multiple pathways including DNA repair (through APEX1), cell cycle control (via CDKN2A, CDK2), apoptosis (through BCL2), and invasion (via DIA1) . These connections highlight the broader significance of MC1R in cellular biology and underscore the value of comparative studies using recombinant proteins from different species.

MC1R-Mediated Signal Transduction

The Callithrix geoffroyi MC1R, like its counterparts in other species, functions primarily through G protein-coupled signaling pathways. Upon binding melanocortin peptides such as α-MSH, the receptor undergoes conformational changes that activate associated G proteins, particularly Gs, leading to stimulation of adenylyl cyclase and increased production of cyclic AMP (cAMP) . This second messenger then activates protein kinase A (PKA), triggering downstream signaling cascades that ultimately influence gene expression patterns in melanocytes.

Research on human MC1R has demonstrated its connection to the PI3K/Akt pathway, which plays crucial roles in cell survival, proliferation, and metabolism . Specifically, certain MC1R mutations (MC1R-RHC) have been shown to promote PI3K/Akt signaling when exposed to UV radiation, potentially explaining the increased melanoma risk observed in individuals with these variants . While direct evidence for similar mechanisms in Callithrix geoffroyi is currently limited, the high degree of conservation in key functional domains suggests that comparable signaling pathways likely operate across primate species.

Role in Pigmentation and Beyond

The primary function of MC1R in melanocytes is regulating the balance between eumelanin (brown/black pigment) and pheomelanin (yellow/red pigment) production. Activation of MC1R by α-MSH leads to increased eumelanin synthesis, resulting in darker pigmentation . Variations in MC1R sequence can alter this balance, influencing the pigmentation patterns observed across species and individuals.

Beyond pigmentation, emerging research indicates that MC1R influences multiple cellular processes with significant implications for health and disease. Through regulation of the MITF transcription factor, MC1R indirectly affects DNA repair mechanisms, particularly through the APEX1 pathway, which is crucial for responding to reactive oxygen species and oxidative DNA damage . Additionally, MC1R-mediated signaling may influence cell cycle progression, apoptosis resistance, and invasive potential – all factors relevant to cancer development and progression .

These broad cellular effects highlight the multifunctional nature of MC1R and underscore the potential value of recombinant Callithrix geoffroyi MC1R as a comparative model for investigating conserved and divergent aspects of melanocortin signaling across primate species.

Implications for Melanoma Research

The connection between MC1R variants and melanoma risk in humans suggests potential applications for cross-species comparative studies using recombinant MC1R proteins, including the Callithrix geoffroyi variant. Research has demonstrated that human MC1R mutations can promote important cancer-causing pathways, particularly PI3K/Akt signaling, when exposed to UV radiation .

Studies examining human MC1R variants' impact on 10-year survival after melanoma highlight the clinical relevance of this receptor in human health . By investigating whether similar mechanisms operate in other primates, researchers may identify conserved pathways critical for melanoma development and potential targets for therapeutic intervention.

The availability of recombinant Callithrix geoffroyi MC1R facilitates comparative oncology research without the need for direct animal experimentation, potentially contributing to both evolutionary understanding and translational medicine. Such studies may reveal protective mechanisms that have evolved in different primate lineages, possibly informing novel approaches to melanoma prevention and treatment in humans.

Evolutionary and Comparative Biology

Recombinant Callithrix geoffroyi MC1R serves as a valuable tool for evolutionary and comparative biology research. By comparing the structure and function of MC1R across primate species, researchers can trace the evolutionary history of this important pigmentation gene and identify molecular adaptations associated with different ecological niches and environmental pressures.

The specific characteristics of Callithrix geoffroyi MC1R likely evolved in response to selective pressures present in its native Atlantic forest habitat in eastern Brazil. Comparative studies can reveal how variations in MC1R sequence correlate with pigmentation patterns observed across primate species and potentially identify convergent evolutionary solutions to similar environmental challenges.

Additionally, integration of MC1R sequence data with broader genomic analyses can provide insights into the co-evolution of pigmentation genes and their role in primate adaptation and speciation. The recombinant protein enables functional testing of evolutionary hypotheses about receptor performance that would otherwise remain speculative based on sequence analysis alone.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance for arrangement and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Callithrix geoffroyi (Geoffroy's marmoset)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNPGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYXFICCLALSDLLVSGSNMLETAIILLLEAGTLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAIAAIWVASVLSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIIRLHNRQLPAHKGFGLRGA ATLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSSWPGCWAEGGGDSVWPGSCVTLRGPLPP
Uniprot No.

Target Background

Function
This receptor binds to Melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through the modulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MC1R and what are its primary cellular functions?

MC1R is a G protein-coupled receptor crucial for regulating melanocyte proliferation and function . Upon binding melanocortins such as α-MSH, MC1R activates several signaling cascades, most notably the cAMP pathway leading to the synthesis of photoprotective eumelanin . The receptor is expressed on melanocyte cell surfaces at relatively low densities (approximately 1000 receptors per cell), making receptor processing and trafficking particularly important determinants of cellular responses .

Beyond its classical role in pigmentation, MC1R has established functions in:

  • Activation of DNA damage response mechanisms

  • Facilitation of DNA repair following UV radiation exposure

  • Protection against UV-induced chromosome aberrations

  • Maintenance of centromere integrity

These expanded functions explain why MC1R is considered a melanoma predisposition gene and why certain variants increase cancer susceptibility independently of pigmentation phenotypes .

How does MC1R signaling protect cells from UV damage?

MC1R provides multifaceted protection against UV-induced cellular damage through several mechanisms:

  • Eumelanin production: Upon α-MSH binding, MC1R activates the cAMP signaling pathway, promoting synthesis of photoprotective eumelanin in melanocytes, which provides physical protection against UV radiation .

  • DNA repair activation: MC1R signaling activates DNA repair pathways following UV exposure, helping to correct UV-induced DNA damage. This function extends beyond pigmentation and represents a direct mechanism for preventing photocarcinogenesis .

  • Maintenance of chromosome stability: Research has demonstrated that α-MSH/MC1R signaling protects melanocytes from accumulating UV-induced chromosome aberrations, with specifically high protection against centromeric fragmentations .

  • Centromere integrity preservation: MC1R plays a critical role in maintaining centromere integrity following UV exposure, which is essential for proper chromosome segregation during cell division .

These protective functions are compromised in individuals with certain MC1R variants, particularly the red hair color (RHC) alleles, which explains the increased UV sensitivity and skin cancer risk associated with these variants .

What methodological approaches are used to study MC1R trafficking and localization?

Several methodological approaches are employed to study MC1R trafficking and localization:

  • Post-translational modification analysis: MC1R undergoes multiple post-translational modifications including oligomerization, glycosylation, palmitoylation, and phosphorylation that affect its trafficking and function .

  • Oligomerization studies: MC1R forms dimeric or oligomeric species, similar to other melanocortin receptors. Techniques for studying MC1R dimerization have been established and are important for understanding receptor trafficking and functional properties .

  • Trafficking pathway investigation: Anterograde trafficking of newly synthesized MC1R from the endoplasmic reticulum to the plasma membrane is studied to understand factors affecting receptor surface expression .

  • Mutant variant analysis: Natural MC1R variants, particularly the RHC alleles, serve as models for studying receptor trafficking defects and their impact on cellular responses .

  • Transcript variant analysis: Analysis of alternative MC1R transcript splicing and how environmental cues regulate the relative proportions of different transcripts provides insights into receptor expression regulation .

These approaches have revealed that alterations in MC1R trafficking significantly impact cellular responses to agonists, which is particularly important given the low density of MC1R molecules on melanocyte surfaces .

How does MC1R contribute to chromosome stability and centromere integrity?

Recent research has revealed a critical role for MC1R in maintaining chromosome stability and centromere integrity, particularly following UV radiation exposure . Experimental evidence supporting this function includes:

  • Differential chromosome stability in MC1R-intact versus MC1R-silenced cells: Human primary melanocytes with wild-type MC1R show greater chromosome stability after UV radiation compared to melanocytes with MC1R silencing. This protective effect is enhanced by α-MSH stimulation prior to UVB exposure .

  • Centromeric fragmentation analysis: Using techniques including Giemsa staining, metaphase spread chromosome analysis, telomere fluorescence in situ hybridization (FISH), and centromeric FISH, researchers demonstrated that centromeric fragmentations are the major chromosome aberrations in MC1R-silenced cells following UV exposure .

  • Palmitoylation dependence: The protective effect of α-MSH/MC1R on chromosome stability is abrogated when protein palmitoylation is inhibited with 2-bromopalmitic acid (2-BrP), indicating that MC1R's role in chromosome stability is palmitoylation-dependent .

This research establishes MC1R as a critical factor in maintaining genomic integrity in melanocytes, extending its known functions beyond pigmentation and providing further insight into its role as a skin cancer susceptibility gene .

What is the relationship between MC1R protein palmitoylation and its signaling functions?

MC1R protein palmitoylation is essential for activating MC1R signaling and for its protective effects on genomic integrity . The relationship between palmitoylation and MC1R function has been demonstrated through several experimental approaches:

  • Palmitoylation inhibition studies: When melanocytes are treated with 2-bromopalmitic acid (2-BrP), a general palmitoylation inhibitor, the protective effect of α-MSH/MC1R on chromosome stability is abrogated. Strong cytogenetic alterations are detected in human primary melanocytes after pan-palmitoylation inhibition, even in the presence of α-MSH stimulation .

  • MC1R variant analysis: Researchers have previously reported that MC1R protein is palmitoylated and this modification is involved in maintaining receptor activity. Red hair color (RHC) variants of MC1R show altered palmitoylation patterns that contribute to their loss of function .

  • Therapeutic implications: Activation of MC1R palmitoylation represents a potential intervention strategy to rescue loss-of-function MC1R in RHC-variants, offering therapeutic benefits both in vitro and in vivo .

  • Centromere protection mechanism: The α-MSH/MC1R-protected chromosome stability and centromere integrity are palmitoylation-dependent in melanocytes, suggesting that exogenously activated palmitoylation of MC1R RHC-variants may protect centromere integrity after UV radiation .

These findings establish palmitoylation as a critical post-translational modification regulating MC1R function and highlight a potential therapeutic approach for individuals with loss-of-function MC1R variants .

How do MC1R polymorphisms affect receptor function and disease susceptibility?

The human MC1R gene is highly polymorphic, with approximately 200 coding region allelic variants expressed in different populations . These polymorphisms significantly impact receptor function and disease susceptibility:

  • Red Hair Color (RHC) phenotype association: Specific MC1R variants (particularly V60L, I40T, R142H, R151C, R162P, R160W, and D294H) are strongly associated with the RHC phenotype, which includes red or blonde hair, fair skin, freckling, and increased UV sensitivity .

  • Signaling capacity alterations: RHC-variants cannot stimulate cAMP production as strongly as wild-type MC1R in response to α-MSH stimulation, resulting in loss of function (LOF) of the receptor .

  • Cancer susceptibility: MC1R variants, particularly the RHC alleles, are associated with increased melanoma and nonmelanoma skin cancer risk. Some variants affect melanoma risk independent of pigmentation phenotype, highlighting MC1R's role beyond pigmentation .

  • DNA repair capacity: Individuals with RHC-variant MC1R have compromised DNA repair capacity following UV exposure, contributing to their increased cancer risk .

  • Post-translational modification differences: RHC-variants show alterations in post-translational modifications like palmitoylation that affect receptor trafficking and function .

These natural MC1R variants serve as valuable models for studying structure-function relationships, intracellular trafficking, and functional regulation of the receptor, while also explaining individual differences in UV sensitivity and skin cancer susceptibility .

What experimental techniques are used to investigate MC1R's role in DNA damage response after UV radiation?

Several experimental approaches have been employed to investigate MC1R's role in DNA damage response after UV radiation:

  • UV exposure protocols: Standardized UVB exposure protocols (typically 100 J/m² UVB, a dosage that generates standard erythema) are used to induce DNA damage in melanocytes with varying MC1R status .

  • Chromosome aberration analysis:

    • Giemsa staining of metaphase spreads to visualize chromosome abnormalities

    • Telomere fluorescence in situ hybridization (FISH) to identify telomere-related aberrations

    • Centromeric FISH to specifically detect centromere fragmentation and other centromere-related aberrations

  • MC1R modulation approaches:

    • α-MSH stimulation (typically 10 μM) to activate MC1R signaling

    • shRNA-mediated MC1R silencing to create loss-of-function models

    • Expression of wild-type MC1R or RHC-variants to compare their protective functions

  • Palmitoylation studies: Use of 2-bromopalmitic acid (2-BrP, 50 μM) to inhibit protein palmitoylation and determine its role in MC1R-mediated protection against UV damage .

  • Plasmid and shRNA constructs: Specific constructs targeting human MC1R (shMC1R-1, target sequence: 5′-AAATGTCTCTTTAGGAGCCTG-3′) or mouse MC1R (shmMC1R-A, target sequence: 5′-AATGGAGATCAGGAAGGGATG-3′) are used to create knockdown cell lines for functional studies .

These techniques have been instrumental in establishing MC1R's critical role in protecting against UV-induced DNA damage beyond its classical function in pigmentation regulation .

What are the optimal storage and reconstitution conditions for recombinant Callithrix geoffroyi MC1R protein?

For optimal experimental outcomes, the following technical guidelines should be followed when working with recombinant Callithrix geoffroyi MC1R protein:

Storage conditions:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing is not recommended

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Buffer information:

  • The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

Purity specifications:

  • The protein has a purity greater than 90% as determined by SDS-PAGE

Adhering to these storage and handling recommendations ensures maximum protein stability and activity for experimental applications.

What approaches can be used to study MC1R-mediated signaling pathways?

Multiple experimental approaches can be employed to study MC1R-mediated signaling pathways:

  • cAMP pathway analysis: Since the primary signaling pathway activated by MC1R is the cAMP pathway, measuring intracellular cAMP levels following α-MSH stimulation is a standard approach for assessing MC1R function. This is particularly important given that RHC-variants of MC1R cannot stimulate cAMP production as strongly as wild-type MC1R .

  • Expression systems: Various expression systems using MC1R constructs allow for the study of wild-type and variant MC1R signaling:

    • pcDNA3-Flag-MC1R WT and RHC-variants (R151C, R160W, and D294H) have been generated for functional studies

    • GST-MC1R fusion proteins can be used for protein interaction studies

  • shRNA-mediated knockdown: shRNA constructs targeting human or mouse MC1R can be used to create knockdown cell lines to study the consequences of MC1R deficiency on signaling pathways .

  • Post-translational modification analysis: Given the importance of palmitoylation for MC1R function, analysis of this and other post-translational modifications provides insights into MC1R signaling regulation .

  • Transcript analysis: Analysis of the relative levels of various MC1R-derived transcripts and how they are modified by external signals like α-MSH can reveal regulatory mechanisms affecting MC1R expression and function .

  • Downstream pathway analysis: Beyond cAMP, analysis of MC1R effects on DNA repair pathways and other cellular processes helps to characterize the full range of MC1R-mediated signaling .

These approaches provide complementary information about MC1R signaling and can be tailored to specific research questions about receptor function and regulation.

How can researchers effectively analyze MC1R polymorphisms and their functional consequences?

To effectively analyze MC1R polymorphisms and their functional consequences, researchers can employ several methodological approaches:

  • Expression system comparison: Comparing the signaling capacity of wild-type and variant MC1R in expression systems allows for functional characterization of polymorphisms:

    • pcDNA3-Flag-MC1R constructs containing wild-type MC1R or RHC-variants (R151C, R160W, and D294H) can be expressed in appropriate cell systems

    • cAMP production in response to α-MSH stimulation can be measured to assess signaling capacity

  • UV response analysis: Exposing cells expressing different MC1R variants to standardized UV radiation protocols (e.g., 100 J/m² UVB) and analyzing:

    • Chromosome stability using Giemsa staining and metaphase spread analysis

    • Centromeric integrity using fluorescence in situ hybridization (FISH)

    • DNA repair capacity through various DNA damage assessment assays

  • Post-translational modification assessment: Analyzing how polymorphisms affect critical post-translational modifications:

    • Palmitoylation studies are particularly important given this modification's role in MC1R function

    • Analysis of protein trafficking and localization to understand how variants affect receptor expression and function

  • Rescue strategies: Testing approaches to rescue variant MC1R function:

    • Activation of palmitoylation of MC1R RHC-variants may protect centromere integrity after UV radiation

    • This represents a potential intervention strategy with therapeutic benefit

These methodological approaches have revealed that MC1R variants serve as natural models of genotype-phenotype associations and provide valuable information on MC1R structure-function relationships, intracellular trafficking, and functional regulation .

What experimental design considerations are important when studying MC1R's role in UV-induced DNA damage response?

When designing experiments to study MC1R's role in UV-induced DNA damage response, several critical considerations should be addressed:

  • Cell model selection:

    • Human primary melanocytes with wild-type MC1R provide an ideal physiological model

    • MC1R-silenced melanocytes created using shRNA constructs (e.g., shMC1R-1 with target sequence 5′-AAATGTCTCTTTAGGAGCCTG-3′) allow for loss-of-function studies

    • Expression systems with wild-type or variant MC1R constructs enable comparative functional studies

  • UV exposure parameters:

    • Standardized UVB dose of 100 J/m² generates standard erythema and is commonly used

    • Timing of UV exposure relative to experimental manipulations (e.g., α-MSH stimulation) is critical

  • MC1R activation protocol:

    • α-MSH stimulation (typically 10 μM) prior to UVB exposure activates MC1R signaling

    • Pre-treatment time should be standardized across experimental conditions

  • Post-translational modification control:

    • Inclusion of palmitoylation inhibition controls (e.g., 2-bromopalmitic acid, 50 μM) to evaluate the role of this modification

    • Analysis of other post-translational modifications affecting MC1R function

  • Chromosome stability assessment techniques:

    • Giemsa staining and metaphase spread chromosome analysis for general chromosome aberrations

    • Telomere FISH for telomere-related abnormalities

    • Centromeric FISH for specific analysis of centromere fragmentation

  • Controls and comparisons:

    • Untreated controls

    • UV-only controls

    • α-MSH-only controls

    • Combined treatment groups (α-MSH + UV)

    • Comparison of wild-type versus variant or silenced MC1R responses

These experimental design considerations ensure robust and reproducible results when investigating MC1R's role in protecting against UV-induced DNA damage, particularly its functions in maintaining chromosome stability and centromere integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.