Recombinant Callithrix jacchus Insulin-induced gene 2 protein (INSIG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
INSIG2; Insulin-induced gene 2 protein; INSIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Callithrix jacchus (White-tufted-ear marmoset)
Target Names
INSIG2
Target Protein Sequence
MVEEETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFNREWSNVMRCVAVFVGINH ASAKLDFDNNIQLSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE
Uniprot No.

Target Background

Function
INSIG2 is an oxysterol-binding protein that regulates cholesterol synthesis through feedback control. It mediates this control by influencing both endoplasmic reticulum-to-Golgi transport of SCAP and the degradation of HMGCR. INSIG2 acts as a negative regulator of cholesterol biosynthesis by retaining the SCAP-SREBP complex within the endoplasmic reticulum, thus inhibiting the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2. It binds various oxysterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol, modulating its interaction with SCAP and the retention of the SCAP-SREBP complex. In the presence of oxysterols, INSIG2 interacts with SCAP, retaining the complex in the endoplasmic reticulum and preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi. Sterol deprivation or phosphorylation by PCK1 reduces oxysterol binding, disrupting the INSIG2-SCAP interaction, thereby promoting Golgi transport of the SCAP-SREBP complex, followed by processing and nuclear translocation of SREBF1/SREBP1 and SREBF2/SREBP2. INSIG2 also regulates cholesterol synthesis by controlling HMGCR degradation: it initiates sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR by recruiting the reductase to the ubiquitin ligase RNF139.
Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is INSIG2 and why is the marmoset model relevant for its study?

INSIG2 (Insulin Induced Gene 2) is a protein involved in multiple metabolic pathways, particularly those regulating lipid metabolism and cholesterol biosynthesis. The protein plays a crucial role in the SREBP signaling pathway, which controls cholesterol and fatty acid homeostasis.

Marmosets (Callithrix jacchus) serve as an excellent model for INSIG2 research because:

  • They share close genetic and physiological similarity to humans

  • Their relatively long lifespan (5-7 years with maximum of 16.5 years) allows for longitudinal studies of metabolic conditions

  • They exhibit natural metabolic dysregulation during hepacivirus infection that mirrors human conditions

  • Their small size (350-450g) makes them more manageable than larger primates while still providing translatable results to human physiology

Metabolic studies in marmosets have demonstrated that hepacivirus infection induces changes in insulin signaling, causing several fold increases in plasma insulin and related peptides, suggesting involvement of pathways where INSIG2 functions .

What expression systems are most effective for producing recombinant Callithrix jacchus INSIG2 protein?

Based on available research data, several expression systems have been successfully employed for recombinant protein production from marmoset sources:

Expression SystemAdvantagesLimitationsApplication Notes
E. coliHigh yield, cost-effective, rapid productionLacks post-translational modifications, potential inclusion body formationSuitable for structural studies, antibody production
Mammalian Cells (HEK293)Proper protein folding, post-translational modificationsHigher cost, lower yieldFunctional studies requiring native protein conformation
In Vitro Cell Free SystemRapid production, avoids cellular toxicityLimited scale, higher costPreliminary functional testing
Wheat GermGood for difficult-to-express proteinsSpecialized equipment requiredAlternative when other systems fail

For INSIG2 specifically, E. coli expression has proven successful for other recombinant proteins from marmosets. When expressing membrane-associated proteins like INSIG2, it's essential to optimize solubilization and purification protocols .

The methodology used for recombinant ORF2 protein (p551) of Hepatitis E virus in marmoset studies provides a useful template: the protein was expressed in E. coli and purified by affinity chromatography, forming virus-like particles (VLPs) with a size of 27.71 ± 2.42 nm .

What purification strategies yield the highest purity and biological activity for recombinant marmoset INSIG2?

To achieve optimal purification of recombinant marmoset INSIG2, a multi-step approach is recommended:

  • Affinity Chromatography: Using fusion tags such as His, GST, Fc, Flag, DDK, Myc, or Avi tags to facilitate purification

  • Size Exclusion Chromatography: For separating correctly folded protein from aggregates

  • Ion Exchange Chromatography: For removing contaminants with different charge characteristics

When planning purification:

  • Consider membrane protein nature of INSIG2 and select appropriate detergents for solubilization

  • Validate protein activity at each purification step

  • Assess protein purity using SDS-PAGE and western blotting

  • Confirm structural integrity through circular dichroism or thermal shift assays

Successful examples from marmoset protein production indicate that affinity chromatography is particularly effective for initial capture, as demonstrated in the p551 VLP production model where this approach yielded functional protein capable of inducing immune responses .

How can recombinant marmoset INSIG2 be used to study metabolic dysregulation in hepacivirus infection models?

Marmosets infected with GB virus B (GBV-B, a hepacivirus) develop metabolic abnormalities that mirror those seen in human hepatitis C virus (HCV) infection, including insulin resistance and steatosis. Recombinant marmoset INSIG2 can be invaluable in this research context:

  • As a tool to investigate altered SREBP pathway regulation during infection

  • For developing in vitro assays to measure interaction between viral proteins and INSIG2

  • To generate antibodies for tracking INSIG2 expression and localization changes during infection

  • As a standard for quantitative analyses of endogenous INSIG2 levels

Research has shown that GBV-B infection in marmosets leads to:

  • Several-fold increases in plasma insulin, glucagon, and glucagon-like peptide 1 (GLP-1)

  • Hypertriglyceridemia with up to 10-fold increases in adipocytokines

  • Moderate to severe cytoplasmic changes associated with steatotic changes in liver

These metabolic changes suggest a disruption in pathways involving INSIG2, making recombinant INSIG2 a valuable research tool for investigating infection-induced metabolic syndrome.

What are the implications of genetic variants in marmoset INSIG2 for metabolic disease modeling?

Whole genome sequencing of 84 marmosets has revealed substantial genetic diversity with an average of 5.4 million SNVs per individual. This genetic variability provides opportunities for studying INSIG2 variants and their relationship to metabolic phenotypes:

  • Researchers can identify naturally occurring INSIG2 variants in marmoset populations

  • Association studies between variants and metabolic traits can be conducted

  • Comparative analysis with human INSIG2 variants linked to metabolic disorders is possible

From the 4,956 variants orthologous to human ClinVar SNVs, 27 have clinical significance classified as pathogenic and/or likely pathogenic. This suggests that marmosets may carry variants with functional consequences similar to human disease-associated variants .

When designing studies using marmoset INSIG2 variants:

  • Screen for relevant variants in your colony

  • Consider using CRISPR/Cas9 to generate specific variants of interest

  • Develop assays to measure functional consequences of variants on lipid metabolism

  • Compare findings with human clinical data on similar variants

How should researchers design experiments to investigate INSIG2's role in marmoset models of metabolic syndrome?

When designing experiments to investigate INSIG2's role in marmoset models of metabolic syndrome, consider the following approaches:

  • Longitudinal Studies:

    • Track metabolic parameters (insulin, glucose, lipids) over time

    • Monitor INSIG2 expression in response to dietary interventions

    • Measure changes during disease progression

  • Molecular Methods:

    • Quantify INSIG2 mRNA and protein expression in relevant tissues

    • Conduct ChIP assays to identify transcription factor binding

    • Perform co-immunoprecipitation to identify interaction partners

  • Comparative Analysis:

    • Compare findings between control and metabolically challenged animals

    • Evaluate results alongside human clinical data

    • Consider sex differences in metabolic responses

Parameters to measure include:

  • Plasma insulin, glucagon, and GLP-1 levels

  • Liver enzyme function

  • Adipocytokine profiles (resistin, PAI-1)

  • Triglyceride and cholesterol levels

  • Liver histopathology for steatotic changes

A rigorous experimental design should include appropriate controls and account for the individual variation observed in marmoset populations (5.4 million SNVs per individual on average) .

What methods are most effective for studying the interaction between INSIG2 and SREBP pathways in marmoset liver samples?

To effectively study INSIG2-SREBP pathway interactions in marmoset liver samples, researchers should employ multiple complementary approaches:

  • Molecular Interaction Studies:

    • Co-immunoprecipitation of INSIG2 with SREBP pathway components

    • Proximity ligation assays to visualize protein interactions in situ

    • FRET/BRET analyses for dynamic interaction studies

  • Functional Assays:

    • Luciferase reporter assays to measure SREBP-dependent transcriptional activity

    • ChIP-seq to identify genome-wide binding patterns of SREBP

    • Metabolic labeling to track cholesterol synthesis rates

  • Histological and Imaging Methods:

    • Immunohistochemistry to localize INSIG2 and SREBPs in liver sections

    • Electron microscopy to evaluate ER membrane structure

    • Lipid staining to assess hepatic steatosis

The SREBP pathway, in which INSIG2 plays a crucial role, involves multiple proteins including INSIG1, SREBF2, NFYBB, NFYBA, NFYAL, DHCR7, MTF1, YY2, and PMVK . Interactions with these partners should be systematically investigated to understand regulatory mechanisms.

How should researchers interpret changes in INSIG2 expression in the context of hepacivirus-induced metabolic disruption?

When interpreting changes in INSIG2 expression during hepacivirus infection in marmosets, researchers should consider:

  • Temporal Relationships:

    • INSIG2 expression changes relative to viral load

    • Correlation with onset of metabolic abnormalities

    • Persistence after viral clearance

  • Tissue-Specific Patterns:

    • Differential expression across liver zones

    • Expression in non-hepatic tissues affected by metabolic dysfunction

    • Correlation with histopathological changes

  • Pathway Context:

    • Co-regulation with other SREBP pathway components

    • Relationship to changes in insulin signaling pathways

    • Correlation with lipogenic gene expression

Research has demonstrated that GBV-B infection in marmosets leads to metabolic abnormalities that persist even after viral clearance, suggesting long-term disruption of metabolic regulation pathways. Specifically, infected animals show transient weight loss followed by hypertriglyceridemia and increased adipocytokines (resistin, PAI-1), indicating potential compensatory mechanisms in lipid metabolism regulation that may involve INSIG2 .

TimepointTypical Metabolic ChangesRecommended INSIG2 Analysis
Early infection (0-28 days)Transient weight loss, decline in blood glucoseMeasure acute changes in INSIG2 expression, localization
Mid infection (28-168 days)Rising insulin, glucagon, and GLP-1 levelsAssess INSIG2 relationship to insulin signaling pathways
Late/post infection (>168 days)Hypertriglyceridemia, steatotic liver changesEvaluate INSIG2 role in persistent metabolic dysregulation

What bioinformatic approaches are recommended for analyzing marmoset INSIG2 in the context of whole genome sequence data?

For comprehensive analysis of marmoset INSIG2 in the context of whole genome sequencing data, consider these bioinformatic approaches:

  • Variant Analysis:

    • Identify SNVs and indels within INSIG2 coding and regulatory regions

    • Compare with human orthologous variants using liftOver tools

    • Annotate functional consequences using tools like SnpEff or VEP

  • Population Genetics:

    • Calculate allele frequencies of INSIG2 variants in marmoset populations

    • Assess linkage disequilibrium patterns around INSIG2

    • Perform selection analyses to identify evolutionary constraints

  • Regulatory Network Analysis:

    • Identify transcription factor binding sites in INSIG2 regulatory regions

    • Construct co-expression networks including INSIG2 and related genes

    • Perform pathway enrichment analysis for genes co-regulated with INSIG2

The high-quality marmoset reference genome (contig N50 = 25.23 Mbp, scaffold N50 = 98.2 Mbp) provides a solid foundation for these analyses. Researchers should leverage the identified 19.1 million SNVs and 2.8 million small insertion/deletion variants to contextualize INSIG2 variation .

When analyzing variants, consider both coding changes and those in regulatory regions, as both can impact INSIG2 function and expression. Compare findings with human data, particularly the 27 variants with pathogenic/likely pathogenic clinical significance to identify functionally important regions .

What are common challenges in producing and working with recombinant marmoset INSIG2 and how can they be addressed?

Researchers working with recombinant marmoset INSIG2 may encounter several challenges:

  • Expression System Issues:

    • Poor expression levels: Optimize codon usage for the expression system

    • Inclusion body formation: Adjust growth temperature, consider fusion partners

    • Toxicity to host cells: Use inducible expression systems, lower expression levels

  • Purification Difficulties:

    • Poor solubility: Test different detergents for membrane protein extraction

    • Degradation during purification: Add protease inhibitors, reduce processing time

    • Low binding to affinity resin: Try alternative tags or tag positions

  • Functional Assessment Challenges:

    • Loss of activity during purification: Validate function at each step

    • Difficulty in assay development: Use well-characterized reference proteins

    • Inconsistent results: Standardize protein batches and assay conditions

Successful approaches from related research include the expression of recombinant proteins in E. coli with subsequent affinity chromatography purification, as demonstrated in the p551 VLP production for HEV studies in marmosets .

How can researchers overcome variability in INSIG2 function across different marmoset subjects?

Genetic diversity in marmosets (average 5.4 million SNVs per individual) can lead to variability in INSIG2 function. To address this:

  • Genetic Screening:

    • Sequence INSIG2 locus in study subjects before experiments

    • Group animals based on genotype when possible

    • Include genotype as a variable in statistical analyses

  • Experimental Design Modifications:

    • Increase sample sizes to account for genetic variability

    • Use paired designs where subjects serve as their own controls

    • Consider family-based designs to control for genetic background

  • Data Analysis Approaches:

    • Apply mixed-effects models to account for individual variation

    • Use genetic information as covariates in analyses

    • Consider pathway-level analysis rather than focusing solely on INSIG2

Research has shown substantial genetic diversity among marmosets from different research centers. When designing studies, consider that animals from different origins (WNPRC, SNPRC, NEPRC, or UK sources) may have distinct genetic backgrounds that could influence INSIG2 function .

How might CRISPR/Cas9 gene editing be applied to study INSIG2 function in marmoset models?

CRISPR/Cas9 gene editing offers powerful approaches for investigating INSIG2 function in marmosets:

  • Functional Variant Creation:

    • Generate marmosets with specific INSIG2 variants found in human metabolic disorders

    • Create reporter knock-ins to track INSIG2 expression in vivo

    • Develop conditional knockout models to study tissue-specific functions

  • Regulatory Element Modification:

    • Edit SREBP binding sites to alter INSIG2 regulation

    • Modify promoter elements to investigate transcriptional control

    • Create inducible expression systems for temporal control

  • Methodological Considerations:

    • Optimize guide RNA design using the marmoset reference genome

    • Establish embryo manipulation and transfer protocols

    • Develop efficient genotyping methods for identifying successful edits

The high-quality reference genome assembly (2.898 Gb marmoset genome) provides an excellent resource for designing precise gene editing strategies . When designing CRISPR experiments, researchers should consider the 74,088 missense variants in protein-coding genes already identified in marmosets to avoid sites with high natural variability.

What novel insights might be gained from integrating marmoset INSIG2 research with multi-omics approaches?

Integration of marmoset INSIG2 research with multi-omics approaches offers opportunities for systems-level understanding:

  • Transcriptomics Integration:

    • Correlate INSIG2 expression with global gene expression patterns

    • Identify co-regulated gene networks during metabolic challenges

    • Map temporal transcriptional responses to interventions

  • Proteomics Applications:

    • Map the INSIG2 interactome in different metabolic states

    • Quantify post-translational modifications affecting function

    • Monitor protein abundance changes in response to metabolic stressors

  • Metabolomics Connections:

    • Link INSIG2 function to lipid profile changes

    • Identify metabolic signatures of altered INSIG2 activity

    • Develop biomarkers for INSIG2-related metabolic disruption

  • Integration Strategies:

    • Apply network analysis to identify key nodes connecting INSIG2 to metabolic outcomes

    • Use machine learning to predict phenotypic consequences of INSIG2 variants

    • Develop computational models of INSIG2's role in lipid homeostasis

Hepacivirus infection studies in marmosets have already demonstrated complex metabolic disruptions, including altered insulin signaling and lipid metabolism . Multi-omics approaches could reveal how INSIG2 connects these phenomena, potentially identifying novel intervention targets for metabolic disorders.

How can findings from marmoset INSIG2 research inform human metabolic disease understanding and treatment?

Research on marmoset INSIG2 has significant translational potential for human metabolic diseases:

  • Comparative Biology Insights:

    • Identify conserved and divergent aspects of INSIG2 function

    • Validate findings from rodent models in a primate system

    • Bridge the gap between animal models and human clinical observations

  • Therapeutic Target Validation:

    • Test hypothesis about INSIG2 as a drug target in a relevant primate model

    • Evaluate effects of INSIG2 modulation on metabolic parameters

    • Identify potential off-target effects before human trials

  • Biomarker Development:

    • Correlate INSIG2 variants with metabolic phenotypes

    • Identify downstream effectors that could serve as accessible biomarkers

    • Develop assays to monitor INSIG2 pathway activity in clinical samples

The close genetic relationship between marmosets and humans makes findings particularly relevant. Of the 4,956 variants orthologous to human ClinVar SNVs, 27 have clinical significance classified as pathogenic and/or likely pathogenic, suggesting shared mechanisms of disease .

The conservation of metabolic dysregulation pathways between hepacivirus-infected marmosets and humans with HCV suggests that insights into INSIG2's role could be directly applicable to human metabolic syndrome, particularly in the context of viral hepatitis .

What ethical considerations should guide the use of marmosets in INSIG2 and metabolic disease research?

When conducting INSIG2 research using marmoset models, researchers must carefully consider several ethical dimensions:

  • 3Rs Framework Implementation:

    • Replacement: Use in vitro or computational approaches when possible

    • Reduction: Optimize study design to minimize animal numbers

    • Refinement: Implement least invasive procedures and appropriate analgesia

  • Study Design Considerations:

    • Justify marmoset use over other models based on scientific necessity

    • Ensure adequate statistical power with minimum number of animals

    • Design longitudinal studies to maximize data from each subject

  • Colony Management:

    • Maintain genetic diversity in research colonies

    • Consider the social nature of marmosets in housing arrangements

    • Implement environmental enrichment appropriate for the species

  • Translational Value Assessment:

    • Regularly evaluate the translational relevance of findings

    • Ensure data sharing to prevent unnecessary duplication of studies

    • Collaborate across institutions to maximize knowledge gained

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.