Recombinant Callithrix jacchus Lutropin-choriogonadotropic hormone receptor (LHCGR)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant marmoset LHCGR is produced using heterologous expression systems, with parameters optimized for high yield and purity .

Table 1: Production Parameters

ParameterDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian cells
Purity≥85% (SDS-PAGE)
ReconstitutionLyophilized form reconstituted in deionized water (0.1–1.0 mg/mL)
Storage12 months at -20°C/-80°C (lyophilized); 6 months (liquid)

Role of Exon 10 and C-Terminal Peptide (CTP)

Marmoset LHCGR’s lack of exon 10 impairs LH-mediated signaling but preserves CG activity. The CTP of CG compensates for this structural deficiency by facilitating receptor activation :

  • Key finding: CG with intact CTP induces 3–4x higher cAMP production compared to CG lacking CTP .

  • Mechanism: CTP stabilizes receptor conformation, enabling signal transduction despite the absence of exon 10 .

Signaling Pathways

  • Primary pathway: Activates cAMP/protein kinase A (PKA) cascade upon hormone binding .

  • Cross-reactivity: Binds both LH and CG but shows species-specific efficacy .

Research Applications

Recombinant marmoset LHCGR is widely used in:

  1. Biochemical assays: Ligand-binding studies using radioimmunoassays .

  2. Structural biology: Investigating GPCR activation mechanisms .

  3. Drug development: Screening compounds targeting reproductive disorders .

Pharmacological Relevance

While direct therapeutic use in humans is limited, marmoset LHCGR studies inform human reproductive research:

  • Comparative models: Marmoset LHCGR’s exon 10 deficiency mirrors certain human LHCGR mutations linked to infertility .

  • Drug analogs: Recombinant LH analogs (e.g., lutropin alfa) leverage structural insights from GPCR studies .

Challenges and Future Directions

  • Limitations: Low solubility in non-lyophilized forms .

  • Opportunities: Engineering chimeric receptors to study exon 10’s role in signal bias .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LHCGR; Lutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-676
Protein Length
Full Length of Mature Protein
Species
Callithrix jacchus (White-tufted-ear marmoset)
Target Names
Target Protein Sequence
EARCCPEPCNCTPDGALRCPGPGAGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQSDS LERIEANAFDNLLNLSEILIQNTKNLIHIEPGAFTNLPRLKYLSICNTGIRKFPDVTKIF SSETNFILEICDNLHITTIPGNAFQGMNNESITLKLYGNGFEEVQSHAFNGTTVISLVLK ENVHLERIHNGAFRGATGPSILDISSTKLQALPSHGLESIQTLIATSSYSLKKLPSREKF ANLLDATLTYPSHCCAFRNVPTKDYPAIFAESGQSGWDYDYGFHLPKTPRCAPEPDAFNP CEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYL LLIASVDSQTKGQYYNHAIDWQTGSGCNTAGFFTVFASELSVYTLTVITLERWHTITYAI HLDQKLRLRHAILIMLGGWLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQIYILTIL ILNVVAFIIICACYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISA AFKMPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTFRRDFFLLLGKFGCCKHRAELYR RKDFSAYTSNYKNGFTGSSKPSQSTLKLPALHCQGTALLDKTCYKEY
Uniprot No.

Target Background

Function
This protein acts as a receptor for lutropin-choriogonadotropic hormone. Its activity is mediated by G proteins that activate adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is unique about the Callithrix jacchus LHCGR compared to human LHCGR?

The marmoset monkey (Callithrix jacchus) LHCGR naturally lacks exon 10, making it a type II LHR. This structural difference is significant because exon 10 encodes the receptor's hinge region. In human and other mammalian LHRs that contain exon 10, this region plays a critical role in hormone binding and receptor activation. The absence of exon 10 impairs LH action on the marmoset receptor while CG maintains normal activity .

This structural difference has important functional consequences, particularly in how the receptor responds to different ligands. The exon 10 deficiency affects signal transduction pathways and may explain why marmosets respond differently to certain reproductive hormones compared to humans.

How does the structure of Callithrix jacchus LHCGR influence hormone binding?

The absence of exon 10 in marmoset LHCGR creates a distinct binding interface for gonadotropic hormones. Current models suggest that exon 10 typically plays a permissive role in releasing receptor constraints upon hormone binding. When this exon is absent, as in the marmoset LHCGR, the carboxyterminal peptide (CTP) present in chorionic gonadotropin (CG) can compensate by facilitating the "opening" of the receptor, resulting in normal activation .

The structural differences in the L2-beta loop between human LH and CG are particularly relevant when interacting with marmoset LHCGR. Sequence analysis comparing human hormones with marmoset counterparts reveals key differences in the interaction elements that affect binding affinity and receptor activation .

What are the optimal expression systems for producing functional recombinant Callithrix jacchus LHCGR?

Functional recombinant expression of marmoset LHCGR has been successfully achieved using mammalian cell systems. The methodology typically involves:

  • Amplification of the marmoset LHCGR gene using standard PCR techniques

  • Subcloning into appropriate expression vectors (commonly pEGFP-N1)

  • Transfection into mammalian cell lines such as COS7 cells

  • Establishment of stable cell lines expressing the recombinant receptor

For optimal expression, the following parameters have proven effective:

  • Vector selection: Vectors with strong promoters like CMV enhance expression

  • Cell line selection: COS7 cells have demonstrated good expression levels and proper protein folding

  • Selection markers: Antibiotic resistance genes (commonly neomycin) facilitate selection of stable transfectants

Researchers should verify receptor expression through Western blotting and confirm functionality through cAMP assays upon stimulation with appropriate ligands .

How can researchers generate and validate recombinant marmoset gonadotropins for LHCGR activation studies?

Generating functional recombinant marmoset gonadotropins requires:

  • Cloning and expression: The genes encoding marmoset LH or CG α and β subunits are cloned into mammalian expression vectors.

  • Purification protocol: Typically involves immunoaffinity chromatography using antibodies against the hormone or affinity tags.

  • Calibration: Recombinant preparations must be calibrated against international standards (e.g., WHO LH80/522) using bioassays such as mouse Leydig cell assays.

  • Functional validation: Activity is confirmed through dose-response curves measuring cAMP production in cells expressing the receptor.

A comparative study between wild-type CG and truncated CG lacking the CTP (CG-CTP) showed significant differences in cAMP production. The ED50 of calibrated CG preparation on COS7 cells expressing marmoset LHCGR was 4.25 ± 0.21 IU/L (n = 3). At saturating concentrations (8 IU/L), CG-CTP stimulation resulted in 3-4 times lower cAMP production compared to wild-type CG .

What cell-based assays are most effective for studying signal transduction through Callithrix jacchus LHCGR?

The most effective cell-based assays for studying marmoset LHCGR signaling include:

cAMP Assays:

  • Radioimmunoassay (RIA)

  • Enzyme immunoassay (EIA)

  • FRET-based cAMP sensors

  • Luciferase reporter systems driven by cAMP response elements

Receptor Binding Assays:

  • Radioligand binding assays using 125I-labeled gonadotropins

  • Competition binding assays to determine relative binding affinities

Downstream Signaling Assays:

  • Western blotting for ERK1/2 phosphorylation

  • Calcium mobilization assays

  • β-arrestin recruitment assays

When comparing signaling between different hormone preparations, researchers should employ two-way ANOVA statistical analysis to determine significant differences in dose-response relationships, as demonstrated in the CG versus CG-CTP comparison studies .

How do structural differences in Callithrix jacchus LHCGR impact signaling pathway activation compared to human LHCGR?

The absence of exon 10 in marmoset LHCGR creates significant differences in signaling pathway activation. Research has revealed:

  • Differential G-protein coupling: The hinge region encoded by exon 10 influences coupling efficiency to different G proteins. Marmoset LHCGR may demonstrate altered G protein preference compared to human LHCGR.

  • Ligand-dependent signaling bias: The lack of exon 10 alters the conformational changes induced by different ligands. This results in differential activation of downstream pathways:

    • cAMP/PKA pathway

    • β-arrestin recruitment

    • ERK1/2 activation

  • Receptor thermostability differences: Comparative studies of marmoset and human hormone receptors have shown differences in thermostability. For example, marmoset FSH demonstrated approximately 20% greater thermostability than human FSH on both marmoset and human FSH receptors .

These structural differences have important implications for using marmosets as models for human reproductive biology. The unique signaling properties of marmoset LHCGR must be considered when translating findings to human applications.

How do evolutionary changes in the Callithrix jacchus LHCGR relate to reproductive adaptations in this species?

Evolutionary analysis of marmoset LHCGR reveals important adaptations related to the species' unique reproductive biology:

  • Absence of hydrophobic tail: Unlike human LH β-subunit, the marmoset LH lacks a hydrophobic tail in the β-subunit. This structural difference facilitates activation of the exon 10-deficient marmoset LHCGR .

  • Genomic adaptations: The high-quality diploid genome assembly of Callithrix jacchus has revealed significant heterozygosity (1.36% of the genome) and evolutionary signatures in reproductive genes. Many genes involved in reproduction show evidence of positive selection that may contribute to marmoset-specific reproductive features .

  • Receptor-hormone co-evolution: The LH/CG system in marmosets demonstrates co-evolutionary adaptation between receptor and ligand. The absence of exon 10 in the receptor is complemented by specific changes in the hormone structure, particularly the role of the CTP in CG, which can overcome the absence of exon 10 and facilitate receptor activation .

This co-evolution likely supports the marmoset's unique reproductive features, including high fecundity and frequent twinning, by optimizing gonadotropin signaling pathways for these specialized reproductive strategies.

What are the key considerations when using marmoset LHCGR as a model for human LHCGR in drug development studies?

Researchers using marmoset LHCGR as a model for human applications should consider:

  • Structural differences: The absence of exon 10 in marmoset LHCGR creates fundamental differences in receptor activation mechanisms. Drug candidates targeting specific conformational states may behave differently between species.

  • Signaling pathway divergences: Comparative signaling studies have shown:

    Signaling PathwayHuman LHCGRMarmoset LHCGR
    cAMP productionHigh with both LH and CGHigher with CG than LH
    β-arrestin recruitmentLigand-dependentAltered dynamics
    ERK1/2 activationRobustMay differ in kinetics
  • Pharmacological differences:

    • Potency differences: Compounds may show species-specific potency variations

    • Efficacy differences: Maximum response levels may differ

    • Binding kinetics: Association/dissociation rates may vary

  • Dosing considerations: Species differences in receptor pharmacology necessitate careful translation of dosing regimens. For example, FSH administration for superovulation requires extremely high doses in marmosets compared to humans, though this is not explained by enhanced biopotency of the natural animal's gonadotropin .

These considerations highlight the need for careful validation when extrapolating findings from marmoset models to human applications.

What are common challenges in expressing functional recombinant Callithrix jacchus LHCGR, and how can they be addressed?

Researchers commonly encounter several challenges when expressing functional marmoset LHCGR:

  • Poor expression levels:

    • Solution: Optimize codon usage for the expression system; use strong promoters; consider expression in CHO or HEK293 cells which have shown good results for GPCR expression

  • Improper protein folding:

    • Solution: Expression at lower temperatures (30-32°C); addition of chemical chaperones such as 4-phenylbutyrate or glycerol to culture media

  • Receptor mislocalization:

    • Solution: Add trafficking-enhancing sequences; verify proper glycosylation; consider fusion with fluorescent proteins to monitor localization

  • Low functional response:

    • Solution: Ensure proper post-translational modifications by using mammalian expression systems; co-express relevant G proteins if necessary

  • Receptor instability:

    • Solution: Add stabilizing mutations identified through alanine scanning or directed evolution; use detergents optimized for GPCR stability in membrane preparations

When troubleshooting, systematic comparison to human LHCGR expression under identical conditions provides valuable reference points for optimization strategies .

How can researchers optimize ligand binding assays for Callithrix jacchus LHCGR?

Optimization of ligand binding assays for marmoset LHCGR requires attention to several key parameters:

  • Ligand preparation:

    • Use freshly prepared labeled ligands

    • For radioligand assays, ensure high specific activity (>100 Ci/mmol)

    • For fluorescent ligands, verify that labeling doesn't interfere with binding

  • Membrane preparation:

    • Harvest cells at optimal confluence (80-90%)

    • Use gentle homogenization to preserve receptor integrity

    • Remove nuclei and unbroken cells by low-speed centrifugation

    • Store membranes at -80°C with protease inhibitors

  • Binding conditions:

    • Optimize buffer composition (typically 50 mM Tris-HCl, pH 7.4, 5 mM MgCl2)

    • Determine optimal protein concentration (typically 10-50 μg/ml)

    • Establish appropriate incubation time and temperature (typically 1-2 hours at room temperature)

  • Data analysis considerations:

    • Use appropriate models (one-site, two-site binding)

    • Account for non-specific binding

    • Calculate Kd and Bmax values using non-linear regression

    • For competition assays, calculate Ki values using the Cheng-Prusoff equation

For marmoset LHCGR specifically, researchers should be aware that binding characteristics may differ from human LHCGR due to structural differences in the hormone-binding domain, particularly the absence of exon 10 .

What approaches can resolve discrepancies in signaling data between different experimental systems studying Callithrix jacchus LHCGR?

When facing discrepancies in signaling data across experimental systems, researchers should:

  • Standardize expression levels:

    • Quantify receptor expression through Western blotting or radioligand binding

    • Normalize signaling data to receptor expression levels

    • Consider using inducible expression systems to control expression levels

  • Validate signaling assays with positive controls:

    • Use forskolin as a direct activator of adenylyl cyclase

    • Include well-characterized receptor agonists as reference compounds

    • Perform parallel experiments with human LHCGR for comparison

  • Assess influence of cellular background:

    • Compare results across multiple cell lines (HEK293, CHO, COS7)

    • Quantify expression of relevant G proteins and downstream effectors

    • Consider endogenous phosphodiesterase activity that may affect cAMP levels

  • Analyze kinetic aspects of signaling:

    • Perform time-course experiments to identify optimal measurement windows

    • Consider desensitization effects in prolonged stimulation protocols

    • Assess both early (G protein-dependent) and late (β-arrestin) signaling events

  • Statistical approaches to reconcile data:

    • Use multiple statistical methods to analyze data (parametric and non-parametric)

    • Consider Bland-Altman plots for method comparison

    • Implement Bayesian approaches to incorporate prior knowledge

When comparing data between human and marmoset LHCGR, researchers should be particularly attentive to differences in dose-response relationships, as the unique structure of marmoset LHCGR may result in shifted potency or efficacy profiles for various ligands .

How might CRISPR-Cas9 gene editing be applied to study Callithrix jacchus LHCGR function in vivo?

CRISPR-Cas9 technology offers powerful approaches to study marmoset LHCGR function:

  • Targeted mutations:

    • Introduction of human exon 10 into marmoset LHCGR to study functional consequences

    • Mutation of specific residues to identify critical binding and signaling determinants

    • Creation of chimeric receptors to map domain-specific functions

  • Reporter knock-ins:

    • Integration of luciferase or fluorescent reporters downstream of LHCGR to monitor expression in vivo

    • Tagging endogenous LHCGR with fluorescent proteins to track localization and trafficking

  • Conditional knockout strategies:

    • Tissue-specific LHCGR deletion to dissect function in specific cell types

    • Inducible knockout systems to study temporal aspects of receptor function

  • Methodological considerations:

    • Delivery methods: Lentiviral vectors or direct embryo microinjection

    • Validation: Sequencing, protein expression analysis, and functional assays

    • Off-target analysis: Whole genome sequencing to identify unintended modifications

The high-quality diploid reference genome available for Callithrix jacchus facilitates efficient guide RNA design and off-target prediction, enhancing the feasibility of CRISPR applications in this species .

What are the implications of Callithrix jacchus LHCGR polymorphisms for reproductive biology research?

Research on LHCGR polymorphisms has significant implications for reproductive biology:

  • Natural variants in marmoset populations:

    • Polymorphisms may contribute to individual variation in reproductive success

    • Some variants might be associated with reproductive disorders or subfertility

    • Population studies can reveal selection pressures on receptor function

  • Comparative analysis with human polymorphisms:

    • Human LHCGR polymorphisms have been associated with polycystic ovary syndrome (PCOS) and other reproductive disorders

    • Studies on the rs4953616 polymorphism showed that mutant genotype (TT) conferred 1.77 times risk towards PCOS in humans

    • Comparing functional effects of equivalent polymorphisms between species can provide evolutionary insights

  • Functional characterization approaches:

    • In vitro expression of variant receptors to assess signaling differences

    • Ex vivo tissue culture systems to study physiological responses

    • Development of marmoset models expressing human LHCGR variants

  • Translational potential:

    • Identification of variants that affect response to fertility treatments

    • Development of personalized approaches to reproductive medicine

    • Insight into evolutionary adaptations in reproductive biology

The study of natural and engineered LHCGR variants in marmosets can provide valuable insights into receptor function that may have translational relevance for human reproductive health .

How might artificial intelligence and computational modeling advance our understanding of Callithrix jacchus LHCGR structure-function relationships?

Advanced computational approaches offer powerful tools for studying marmoset LHCGR:

  • Structural modeling and simulations:

    • Homology modeling based on crystal structures of related GPCRs

    • Molecular dynamics simulations to study receptor dynamics and ligand interactions

    • Identification of allosteric binding sites for potential drug development

  • Machine learning applications:

    • Prediction of ligand binding affinities using quantitative structure-activity relationship (QSAR) models

    • Classification of agonist vs. antagonist properties based on molecular features

    • Identification of critical amino acid residues for receptor function

  • Systems biology approaches:

    • Modeling of receptor signaling networks to predict pathway crosstalk

    • Integration of -omics data to understand receptor function in broader cellular context

    • Prediction of phenotypic outcomes from genetic variations

  • Evolutionary analysis:

    • Ancestral sequence reconstruction to trace evolutionary changes in LHCGR

    • Detection of selection signatures to identify functionally important regions

    • Comparative analysis across primate species to understand adaptation

These computational approaches, combined with experimental validation, can accelerate understanding of how the unique structural features of marmoset LHCGR, particularly the absence of exon 10, influence receptor function and contribute to species-specific reproductive biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.