Recombinant Callithrix jacchus Myelin-oligodendrocyte glycoprotein (MOG)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Callithrix jacchus Myelin-Oligodendrocyte Glycoprotein (MOG)

Recombinant Callithrix jacchus Myelin-Oligodendrocyte Glycoprotein (MOG) refers to a synthetically produced version of the MOG protein found in the common marmoset (Callithrix jacchus) . MOG is a protein expressed on the surface of oligodendrocytes and myelin sheaths in the central nervous system . Recombinant MOG is utilized in research to study autoimmune responses, particularly in the context of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE) .

Background and Significance

MOG is a key target in autoimmune demyelinating diseases . In MS, the immune system attacks the myelin sheath, leading to neurological dysfunction . EAE is an animal model of MS, often induced by immunizing animals with MOG or MOG peptides to study the disease mechanisms and test potential therapies . Callithrix jacchus, the common marmoset, is a valuable preclinical model for MS research because EAE induced in marmosets closely mimics the characteristics of MS in humans .

Production and Characterization

Recombinant Callithrix jacchus MOG is typically produced using recombinant DNA technology . The gene encoding C. jacchus MOG is inserted into an expression vector, which is then introduced into host cells (e.g., Escherichia coli) for protein production . The expressed protein is then purified for use in experiments .

Use in Experimental Autoimmune Encephalomyelitis (EAE) Studies

  1. EAE Induction: Recombinant C. jacchus MOG is used to induce EAE in marmosets, serving as a model for MS . The protein is emulsified with an adjuvant (e.g., Freund's adjuvant) to enhance the immune response and injected into the animals .

  2. Immune Response Analysis: Researchers use recombinant MOG to study the T and B cell responses involved in the pathogenesis of EAE . This includes analyzing the specificity diversification of anti-MOG T cells and the role of anti-MOG antibodies .

  3. Evaluation of Therapeutic Interventions: The EAE model is used to test the efficacy of potential therapeutic interventions for MS. Recombinant MOG is crucial in these studies for monitoring the immune responses and clinical outcomes following treatment .

Research Findings

  1. Antibody Specificities: Studies using recombinant C. jacchus MOG have characterized the anti-MOG antibody specificities in marmosets with EAE. These studies have shown that marmosets produce antibodies against conformational epitopes of MOG .

  2. T Cell Responses: Research has demonstrated that the rate of disease progression in marmoset EAE models correlates with the diversity of anti-MOG T cell responses . Fast progressor monkeys show a wider specificity diversification of anti-MOG T cells compared to slow progressors .

  3. Pathogenic Mechanisms: Recombinant MOG has facilitated the investigation of pathogenic mechanisms in EAE, revealing the importance of both T and B cells in disease development . Studies have also explored the role of MOG-specific antibodies in facilitating demyelination .

Examples of Experimental Procedures

  • Immunization: Marmosets are immunized with 50 μg of recombinant rat MOG protein (aa1–125) expressed in E. coli . The protein is purified to homogeneity and emulsified with an equal volume of complete Freund's adjuvant (CFA) .

  • Antibody Binding Assays: Recombinant MOG is used to assess the binding of antibodies in ELISA assays. For example, ELISA plates are coated with rMOG, and the binding of biotinylated anti-MOG antibodies or MOG-specific Fab fragments is determined .

  • Immunohistochemistry: Recombinant MOG-specific Fab fragments are used in immunohistochemistry to identify MOG epitopes in brain sections . Brain sections are incubated with biotinylated Fab fragments, followed by detection with an alkaline phosphatase-conjugated avidin complex and a VectorRed AP substrate .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOG; Myelin-oligodendrocyte glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-245
Protein Length
Full Length of Mature Protein
Species
Callithrix jacchus (White-tufted-ear marmoset)
Target Names
MOG
Target Protein Sequence
GQFRVIGPSHPIQALVGDAAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDGE QAPEYRGRTELLKDDIGEGKVTLKIRNVRFPDEGGFTCFFRDHSYQEEAAMQLKVEDPFY WVSPGVLVLLAVLPVLFLQITVGLVFLYLQHRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Uniprot No.

Target Background

Function
A minor component of the myelin sheath, potentially involved in myelin sheath formation and maintenance, as well as cell-cell communication. It mediates homophilic cell-cell adhesion.
Database Links
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Myelin-oligodendrocyte glycoprotein (MOG) and why is Callithrix jacchus MOG specifically useful in research?

Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) superfamily and a myelin protein expressed exclusively at the outermost surface of myelin sheaths and oligodendrocyte membranes. This specific localization makes MOG particularly accessible to antibodies, positioning it as a potential target for both cellular and humoral immune responses in inflammatory demyelinating diseases . MOG serves as an important marker for oligodendrocyte maturation due to its late postnatal developmental expression pattern . The Callithrix jacchus (common marmoset) MOG has gained significant attention because of its high relevance to human demyelinating disorders, particularly multiple sclerosis (MS).

The use of C. jacchus MOG in research carries distinct advantages over rodent models. Marmosets are non-human primates with closer immunological and neurological similarities to humans than rodents, making them valuable for translational research. Studies have demonstrated that C. jacchus MOG-induced experimental autoimmune encephalomyelitis (EAE) more closely resembles human demyelinating diseases in terms of pathology and immune response characteristics . Unlike rodent models that may not fully recapitulate certain aspects of human disease, marmoset models using C. jacchus MOG have successfully demonstrated the crucial role of B cells and antibody responses in demyelination processes, more accurately reflecting mechanisms believed to be important in human MS pathogenesis.

How does recombinant C. jacchus MOG contribute to understanding autoimmune demyelination?

Recombinant C. jacchus MOG has been instrumental in elucidating the mechanisms of autoimmune demyelination. The protein contains a large N-terminal extracellular IgG V-like domain that is responsible for the formation of demyelinating antibodies, with this N-terminal domain (amino acids 1-125) being particularly critical for pathogenic immune responses . Research using recombinant MOG has revealed that conformational epitopes play a decisive role in the pathogenicity of anti-MOG antibodies, with properly folded protein being essential for generating disease-relevant immune responses . When investigating the immunopathology of demyelinating diseases, researchers have found that antibodies recognizing conformational epitopes of recombinant C. jacchus MOG are strongly associated with demyelinating activity, while antibodies against linear epitopes often lack pathogenic potential.

Studies with marmosets have demonstrated that immunization with recombinant C. jacchus MOG leads to the development of EAE only when animals produce antibodies against conformational epitopes . This finding highlights the importance of protein conformation in disease pathogenesis and has direct implications for understanding human demyelinating disorders. Furthermore, molecular characterization studies have shown that the marmoset MOG-specific antibody repertoire utilizes a limited number of heavy and light chain genes but targets specific conformational epitopes that are consistently recognized across different animals, suggesting common pathogenic mechanisms .

What expression systems are most effective for producing properly folded recombinant C. jacchus MOG?

Mammalian expression systems represent an alternative approach that may better preserve native protein conformation. Cell-based assays using human embryonic kidney (HEK293) cells expressing full-length, conformationally intact MOG have been employed to detect conformational antibodies in patient samples with greater specificity than traditional methods . For researchers requiring recombinant MOG that most closely mimics the native protein, mammalian expression systems offer advantages in terms of post-translational modifications, including appropriate glycosylation patterns. This consideration is particularly important since studies suggest that proper glycosylation of MOG might be involved in maintaining tolerogenic interactions with immune cells through mechanisms such as binding to DC-SIGN on antigen-presenting cells .

How should researchers validate the conformational integrity of recombinant C. jacchus MOG preparations?

Validation of conformational integrity is essential when working with recombinant C. jacchus MOG, as the protein's proper folding directly impacts its experimental utility and relevance to disease modeling. A multi-faceted approach to validation is recommended, beginning with biochemical characterization using circular dichroism spectroscopy to analyze secondary structure elements characteristic of the immunoglobulin fold. This should be complemented by size-exclusion chromatography to confirm the monomeric state of the protein and exclude the presence of aggregates that might expose non-native epitopes. Beyond these basic assessments, functional validation using conformational-specific monoclonal antibodies represents a crucial step in confirming proper protein folding.

The literature demonstrates the value of using well-characterized monoclonal antibodies like 8-18C5, which specifically recognize conformational epitopes of MOG . Researchers can employ competitive binding assays similar to those described in marmoset studies, where various antibody fragments compete for binding to rMOG to confirm the presence of distinct conformational epitopes . Additionally, immunohistochemistry validation can be performed by demonstrating that recombinant MOG-specific antibody fragments can bind to native MOG in situ on CNS myelin, with specificity confirmed by signal quenching after coincubation with recombinant MOG . These validation steps ensure that the recombinant protein presents epitopes in a manner that authentically represents the native protein as it exists in myelin membranes.

What are the critical factors for successful immunization protocols using recombinant C. jacchus MOG?

Successful immunization protocols using recombinant C. jacchus MOG require careful consideration of multiple factors that influence the quality and pathogenicity of the induced immune response. The adjuvant selection significantly impacts disease induction, with complete Freund's adjuvant commonly used in EAE models to promote robust T cell responses alongside antibody production . The physical state and dose of the antigen also critically affect outcomes - researchers must ensure that recombinant MOG maintains its conformational integrity during formulation with adjuvants, as denaturation would alter the epitopes presented to the immune system and potentially reduce pathogenicity.

The route and schedule of administration represent additional important variables. Studies in marmosets have typically employed subcutaneous immunization at multiple sites to maximize exposure to draining lymph nodes, with protocols often involving an initial immunization followed by one or more booster doses . Species considerations must also be addressed when designing immunization protocols - while the same recombinant C. jacchus MOG preparation might be used across different experimental animals, the resulting immune responses can vary significantly between species. For example, research has shown that human MOG, but not rat MOG, induces B cell-dependent EAE in C57BL/6 mice, highlighting the importance of species-specific molecular interactions .

How do antibodies targeting conformational epitopes of C. jacchus MOG differ from those targeting linear epitopes in terms of pathogenicity?

Antibodies targeting conformational epitopes of C. jacchus MOG demonstrate substantially different pathogenic properties compared to those recognizing linear epitopes. Research has conclusively shown that conformation-dependent antibodies are significantly more pathogenic in demyelinating disease models . This pathogenicity difference stems from the ability of conformational antibody specificity to recognize the native MOG protein as it exists on the myelin surface, whereas linear epitope-specific antibodies may bind to peptide sequences that are not naturally exposed in the correctly folded protein. In marmoset studies, immunization with recombinant MOG protein (rMOG) induced antibodies that recognized conformational epitopes and were associated with demyelinating pathology, while immunization with MOG peptide (PepMOG) generated only linear epitope-specific antibodies that lacked pathogenic potential .

The mechanism underlying this differential pathogenicity has been investigated in multiple experimental systems. Conformational MOG antibodies can effectively activate complement-dependent cytotoxicity against cells expressing MOG and directly mediate myelin damage . Studies have demonstrated that patient-derived MOG antibodies enhance demyelination in rat EAE models, with antibody titers against conformational MOG directly associated with EAE activity and demyelination severity . Furthermore, when marmosets were immunized with either rMOG or PepMOG, only those animals producing conformation-dependent antibodies developed demyelinating EAE, despite all animals generating MOG-reactive antibodies as detected by standard assays . This critical distinction highlights the importance of antibody specificity characterization in research and diagnostic applications.

What techniques are most effective for distinguishing between antibodies targeting linear versus conformational epitopes of MOG?

Distinguishing between antibodies targeting linear versus conformational epitopes of MOG requires specialized techniques that preserve or deliberately manipulate protein structure. Cell-based assays (CBAs) using mammalian cells transfected with full-length MOG represent the gold standard for detecting conformational antibodies . In these assays, MOG is expressed on the cell surface in its native conformation, allowing only conformation-dependent antibodies to bind effectively. Flow cytometry or immunofluorescence can then be used to detect this binding, with appropriate controls including untransfected cells and competing antibodies of known specificity. This approach has substantially improved the specificity of MOG antibody detection compared to traditional ELISA-based methods that often fail to maintain native protein conformation.

Differential binding assays provide another effective approach, where parallel testing is performed using both the full-length recombinant protein and synthetic peptides representing linear epitopes. Researchers can compare antibody binding to recombinant MOG before and after denaturation treatments (such as reduction and alkylation or heat treatment) to assess conformation-dependence . Competition experiments similar to those described in marmoset studies also offer valuable insights - these involve examining the ability of different antibody fragments to compete with each other for binding to recombinant MOG, revealing distinct epitope recognition patterns . Additionally, absorption studies where serum samples are pre-incubated with MOG peptides can selectively deplete linear epitope-specific antibodies, allowing separate characterization of the remaining conformation-dependent fraction.

How can researchers characterize the epitope specificity of anti-MOG antibodies generated in their studies?

Characterization of epitope specificity for anti-MOG antibodies requires a multi-dimensional approach to fully understand their binding properties and potential pathogenic relevance. Epitope mapping through the use of mutated recombinant MOG proteins represents a powerful strategy, where systematic amino acid substitutions can identify critical residues involved in antibody binding. This approach has successfully identified immunodominant regions and helped distinguish between different conformational epitopes recognized by various antibody clones. For high-resolution epitope mapping, X-ray crystallography of antibody-antigen complexes provides definitive structural information, though this technique is resource-intensive and challenging to implement routinely.

Competition assays offer a more accessible approach for initial epitope characterization. As demonstrated in marmoset studies, biotinylated antibodies or Fab fragments can be allowed to compete against each other for binding to immobilized recombinant MOG . The observed patterns of competition and displacement reveal whether different antibodies recognize overlapping or distinct epitopes. Importantly, these competition experiments demonstrated that Fab fragments derived from a single animal efficiently displaced serum antibodies from genetically distinct marmosets, indicating that key immunogenic regions of MOG are commonly targeted across individuals . For translational relevance, researchers can conduct cross-species epitope analysis, testing whether antibodies generated against C. jacchus MOG cross-react with human MOG, which provides insights into shared epitopes that may be relevant for human disease.

How does C. jacchus MOG contribute to understanding the pathogenic mechanisms in human demyelinating diseases?

The study of C. jacchus MOG has provided crucial insights into the pathogenic mechanisms underlying human demyelinating diseases, particularly multiple sclerosis (MS). Research using marmoset models has established that recombinant MOG-induced EAE recapitulates key aspects of human disease, including the formation of inflammatory demyelinating lesions with similarities to MS pathology . These models have illuminated the complex interplay between cellular and humoral immunity in demyelination processes. Studies have revealed that MOG-specific antibodies can exacerbate tissue damage through multiple mechanisms, including complement activation, antibody-dependent cellular cytotoxicity, and direct effects on oligodendrocytes . The marmoset model has specifically demonstrated that antibodies targeting conformational epitopes of MOG are essential for the development of demyelinating pathology, a finding with direct relevance to human disease mechanisms .

Molecular characterization of the antibody response in marmosets has uncovered striking parallels to human autoimmunity. The restricted usage of immunoglobulin heavy and light chain genes observed in the marmoset MOG-specific antibody repertoire mirrors similar findings in MS patients, where clonal B cell expansion with restricted usage of germline genes has been reported in CNS lesions and cerebrospinal fluid . Furthermore, competition experiments have demonstrated that antibody fragments derived from marmosets define antigenic determinants of MOG that are commonly targeted across individuals, suggesting conserved immunopathogenic mechanisms . These findings have direct translational implications, as they help identify key epitopes and immune mechanisms that may be targeted for therapeutic intervention in human demyelinating disorders.

What insights have been gained from studying the molecular characteristics of anti-MOG antibodies in C. jacchus models?

The molecular characterization of anti-MOG antibodies in C. jacchus models has revealed significant insights regarding immune responses in demyelinating diseases. Studies have identified that the marmoset MOG-specific antibody repertoire utilizes a limited number of heavy (IGHV1 and IGHV3) and light chain (IGKV1 and IGKV3) subgroup genes, yet employs diverse CDR-encoding gene rearrangements to target only three main epitopes of MOG . This pattern of restricted gene usage with focused epitope targeting suggests that certain structural features of MOG are particularly immunogenic and that the immune response against this protein is not random but follows specific molecular constraints. Such findings parallel observations in MS patients, where restricted usage of immunoglobulin genes has been documented in CNS lesions, suggesting common pathogenic mechanisms across species.

The analysis of antibody binding characteristics has demonstrated that the pathogenicity of anti-MOG antibodies is strictly dependent on their ability to recognize conformational epitopes. Researchers have observed that when marmosets were immunized with either recombinant MOG protein (rMOG) or MOG peptide (PepMOG), all animals developed antibodies detectable in standard assays, but only those producing conformation-dependent antibodies developed demyelinating pathology . This critical distinction helps explain contradictory findings in human studies, where detection of MOG antibodies has not always correlated with disease manifestation. The development of recombinant Fab fragments that define structural determinants of MOG in marmosets has enabled the specific detection of pathogenically relevant antibodies, an approach that has successfully identified similar antibody specificities in human samples .

How do recombinant MOG-specific Fab fragments contribute to antibody characterization in research?

Recombinant MOG-specific Fab fragments have emerged as powerful tools for characterizing pathogenic antibody responses in demyelinating disorders. These fragments, derived from the phage display of antibody libraries from MOG-immunized marmosets, define specific conformational epitopes that are consistently targeted by the humoral immune response . Their utility extends beyond basic epitope mapping, as they provide standardized reagents for detecting and quantifying pathogenically relevant antibodies across different experimental systems and patient cohorts. In marmoset studies, these Fab fragments have been shown to efficiently displace native polyclonal anti-MOG antibodies in competitive binding assays, demonstrating their ability to recognize immunodominant epitopes .

A particularly valuable application of these recombinant Fab fragments is their use in distinguishing pathogenic from non-pathogenic antibody responses. Research has demonstrated that Fab fragments defining structural determinants of MOG can specifically detect the presence of antibodies directed against identical determinants in humans, providing a translational bridge between animal models and human disease . This approach helps overcome limitations of traditional antibody detection methods that fail to differentiate between clinically relevant and irrelevant responses. Furthermore, immunohistochemistry experiments have confirmed that these Fab fragments can bind to the MOG protein in situ on CNS myelin, with specificity demonstrated by complete signal quenching after addition of recombinant MOG . This capability makes them valuable tools for visualizing the distribution and accessibility of MOG epitopes in tissue samples.

What are the key technical challenges in working with recombinant C. jacchus MOG?

Working with recombinant C. jacchus MOG presents several technical challenges that researchers must address to ensure experimental validity. The foremost challenge concerns maintaining protein conformational integrity throughout expression, purification, and experimental procedures. Studies have emphasized that properly folded MOG is essential for generating and detecting pathogenically relevant antibody responses . When expressing recombinant MOG in bacterial systems, researchers face difficulties with protein folding and solubility, often necessitating extensive optimization of refolding protocols to recover the native conformation. This process can be labor-intensive and yield-limiting, requiring careful monitoring through both biochemical and immunological validation steps to confirm proper epitope presentation.

Another significant challenge involves standardization across laboratories and experimental systems. Variations in expression systems, purification methods, and quality control measures can lead to inconsistent results when comparing studies from different research groups. This variability is particularly problematic when attempting to correlate antibody responses with disease manifestations in animal models or clinical samples. Additionally, the species-specific nature of certain MOG epitopes creates complexities when translating findings between different experimental models . For instance, antibodies generated against human MOG may not recognize the same epitopes on rodent MOG, necessitating careful consideration of species-specific differences when designing cross-species studies or interpreting results from different animal models.

How might emerging technologies enhance research applications of recombinant C. jacchus MOG?

Emerging technologies promise to significantly advance research applications of recombinant C. jacchus MOG across multiple domains. Single B-cell cloning and antibody repertoire sequencing technologies are transforming our understanding of the immune response against MOG by enabling comprehensive analysis of B cell populations and their antigen receptors at unprecedented resolution. These approaches allow researchers to track the evolution of MOG-specific antibody responses over time and across different anatomical compartments, providing insights into affinity maturation processes and epitope spreading phenomena that contribute to disease progression. When combined with structural biology techniques such as cryo-electron microscopy, these methodologies can reveal the molecular basis of antibody-antigen interactions with atomic-level precision.

Advanced protein engineering approaches offer avenues for creating modified versions of recombinant MOG with enhanced stability, solubility, or specific epitope presentations. Structure-guided design can produce MOG variants that selectively display certain conformational epitopes while masking others, enabling more precise dissection of antibody specificities and their pathogenic relevance. CRISPR-Cas9 genome editing technologies provide opportunities to develop improved animal models with humanized MOG sequences or specific modifications that recapitulate human disease-associated variants. In the realm of diagnostics, multiplexed assay platforms that simultaneously assess antibody binding to various MOG epitopes could enhance the specificity of clinical testing and provide more nuanced information about the pathogenic potential of patient-derived antibodies.

What are the current limitations in translating findings from C. jacchus MOG research to human demyelinating disorders?

Despite significant advances, several limitations persist in translating findings from C. jacchus MOG research to human demyelinating disorders. The genetic and immunological heterogeneity observed in human patients represents a fundamental challenge, as animal models, even those using non-human primates, cannot fully recapitulate the complex interplay of genetic and environmental factors that influence human disease susceptibility and progression. While marmosets provide a closer approximation to human biology than rodent models, they still differ in aspects of immune system function and regulation that may affect the development and manifestation of autoimmune responses. Additionally, the controlled experimental conditions used in animal studies contrast with the variable and often unknown triggering factors in human disease, complicating direct comparisons.

Temporal aspects of disease progression also present translational challenges. Human demyelinating disorders typically develop over years or decades, with subclinical phases that cannot be readily modeled in experimental settings. By contrast, induced models using recombinant MOG generally produce acute or subacute disease manifestations that may not accurately represent the chronic progressive nature of many human conditions . Furthermore, while studies have identified similarities in antibody responses between marmosets and humans, important differences in epitope recognition patterns and effector mechanisms may exist. The development of increasingly sophisticated humanized models and improved methods for analyzing patient-derived samples will be essential for bridging these translational gaps and leveraging insights from C. jacchus MOG research to advance our understanding and treatment of human demyelinating disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.