Recombinant Callithrix jacchus Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Callithrix jacchus (White-tufted-ear marmoset)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPASQSQHFQN
Uniprot No.

Target Background

Database Links
Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing functional recombinant Callithrix jacchus ST7?

Based on available data for recombinant protein production, several expression systems have been successfully utilized for ST7 proteins. For Callithrix jacchus ST7 specifically, the following systems have demonstrated effectiveness:

  • Mammalian expression systems: HEK293 cells provide proper folding and post-translational modifications crucial for ST7 functionality .

  • E. coli systems: While offering higher yields, bacterial expression may result in improper folding or lack of post-translational modifications .

For optimal expression, consider these methodological approaches:

  • Clone the full-length Callithrix jacchus ST7 coding sequence into vectors containing strong promoters (CMV for mammalian systems, T7 for bacterial systems)

  • Include appropriate fusion tags for detection and purification (His, Fc, or Avi tags have been documented for ST7 proteins)

  • Optimize culture conditions including temperature (30-37°C), induction time (24-72 hours for mammalian systems), and media composition

  • Validate protein expression through Western blot analysis prior to purification

  • Perform functional validation assays to ensure the recombinant protein retains tumor suppressor activity

What are the known protein interactions of ST7 and how can they be experimentally validated?

Current literature identifies NFKBIA (Nuclear Factor Kappa B Inhibitor Alpha) as a direct interaction partner of ST7 . This suggests potential involvement of ST7 in NF-κB signaling pathways relevant to inflammation and cancer.

To investigate and validate protein interactions of Callithrix jacchus ST7, researchers should employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Use antibodies against ST7 to pull down protein complexes, followed by Western blotting or mass spectrometry to identify interacting partners.

  • Proximity-based labeling: BioID or APEX2 fusion proteins can identify proximal proteins in living cells.

  • Yeast two-hybrid screening: Utilize Callithrix jacchus ST7 as bait to screen cDNA libraries.

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI): Quantify binding kinetics between purified ST7 and candidate interactors.

  • Fluorescence resonance energy transfer (FRET): Visualize interactions in living cells using fluorescently tagged proteins.

Validation should include reciprocal Co-IP experiments, domain mapping to identify interaction interfaces, and functional assays to assess the biological significance of identified interactions.

How should researchers approach comparing ST7 between Callithrix jacchus and human models?

Cross-species comparative analysis of ST7 requires systematic approaches to identify conserved and divergent features:

  • Sequence analysis: Perform detailed sequence alignment between Callithrix jacchus and human ST7 to identify:

    • Conserved functional domains

    • Species-specific sequence variations

    • Divergent regulatory regions

  • Structural comparison: Generate homology models of both proteins to identify potential differences in:

    • Secondary and tertiary structure

    • Surface electrostatic properties

    • Ligand binding pockets

    • Post-translational modification sites

  • Functional complementation studies:

    • Introduce Callithrix jacchus ST7 into human cell lines with ST7 mutations/deletions

    • Assess rescue of tumor suppressive functions

    • Compare with human ST7 rescue experiments

  • Cross-species protein interaction analysis:

    • Determine if interaction partners are conserved between species

    • Assess binding affinities of orthologous interactions

    • Identify species-specific interaction partners

When designing experiments, control for species-specific cellular context by using both human and marmoset cell lines when possible, and validate findings across multiple experimental systems.

What purification strategies yield optimal activity for recombinant Callithrix jacchus ST7?

Purification of functionally active recombinant Callithrix jacchus ST7 requires careful consideration of protein characteristics and downstream applications. Based on available approaches for similar proteins, the following purification strategy is recommended:

  • Affinity chromatography (primary capture step):

    • For His-tagged ST7: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • For Fc-tagged ST7: Protein A or Protein G affinity columns

    • For Avi-tagged ST7: Streptavidin-based affinity matrices

  • Ion-exchange chromatography (intermediate purification):

    • Determine theoretical pI of ST7 to select appropriate resin (cation vs. anion exchange)

    • Optimize salt gradient for selective elution

  • Size-exclusion chromatography (polishing step):

    • Separate monomeric ST7 from aggregates and other contaminants

    • Simultaneously perform buffer exchange into storage buffer

Buffer composition significantly impacts ST7 stability and activity. Consider:

  • pH range: 7.2-8.0 to maintain native conformation

  • Salt concentration: 150-300 mM NaCl to prevent aggregation

  • Stabilizing agents: 10% glycerol, 1 mM DTT or 5 mM β-mercaptoethanol for cysteine protection

  • Protease inhibitors: Complete cocktail to prevent degradation during purification

Quality control should include SDS-PAGE, Western blot, mass spectrometry, and functional assays to confirm both purity and activity of the final preparation.

What functional assays are most informative for validating recombinant ST7 activity?

Validating the functional activity of recombinant Callithrix jacchus ST7 requires assays that reflect its tumor suppressor function:

  • Cell-based tumor suppression assays:

    • In vivo tumorigenicity assays: Introduce ST7 into cancer cell lines (e.g., PC3) and assess tumor formation in xenograft models

    • Colony formation assays: Evaluate long-term growth suppression in soft agar

    • Migration and invasion assays: Assess impact on metastatic potential

    • Cell cycle analysis: Identify specific cell cycle effects using flow cytometry

  • Molecular interaction assays:

    • Binding assays with known partners (e.g., NFKBIA)

    • Pull-down assays to confirm preservation of protein-protein interactions

    • SPR or ITC to quantify binding affinities

  • Downstream signaling assays:

    • Reporter gene assays for pathways potentially regulated by ST7

    • Western blot analysis of signaling proteins affected by ST7 expression

    • Transcriptome analysis to identify genes regulated by ST7 activity

  • Control experiments should include:

    • Mutant versions of ST7 with alterations in key functional domains

    • Dose-response studies to establish concentration dependence

    • Time-course experiments to determine temporal dynamics of ST7 activity

When validating recombinant ST7, remember that its tumor suppressive effects may be more pronounced in vivo than in vitro, as demonstrated in published studies .

How should researchers design experiments to investigate the role of ST7 in the LRP pathway?

Evidence suggests ST7 may function as a low-density lipoprotein receptor-related protein (LRP) . To investigate this connection, researchers should design experiments that examine both physical interactions and functional consequences:

  • Interaction analysis:

    • Co-immunoprecipitation of ST7 with LRP family members

    • Proximity ligation assays in intact cells

    • Domain mapping to identify specific interaction interfaces

    • FRET or BRET assays to visualize interactions in living cells

  • LRP pathway functional analysis:

    • LDL uptake assays in cells with modulated ST7 expression

    • Cholesterol quantification using filipin staining or biochemical assays

    • Analysis of downstream signaling pathways (particularly Wnt/β-catenin)

    • Assessment of LDLR and LRP expression levels following ST7 modulation

  • Lipid metabolism studies:

    • Lipidomic analysis in cells with altered ST7 expression

    • Membrane microdomain composition assessment

    • Evaluation of cholesterol efflux pathways

  • Comparative analysis across species:

    • Assess conservation of ST7-LRP interactions between human and Callithrix jacchus

    • Determine if species-specific differences exist in pathway regulation

    • Evaluate evolutionary adaptations in interaction domains

A systematic approach combining these methodologies will provide comprehensive insights into ST7's role in LRP-mediated processes and potential connections to its tumor suppressor function.

What cell models are most appropriate for studying ST7 function?

Selecting appropriate cell models for studying Callithrix jacchus ST7 requires consideration of biological relevance and experimental accessibility:

  • Cell line selection criteria:

    • Species relevance: Marmoset-derived cell lines provide the most appropriate context

    • Cancer relevance: Cell lines with documented ST7 alterations or from cancer types with frequent 7q31 LOH

    • Technical considerations: Transfection efficiency, growth characteristics, and availability

  • Recommended cell models:

Cell TypeFeaturesApplications
Marmoset primary cellsMost physiologically relevantBasic ST7 function studies
Marmoset fibroblastsReadily available, easy to cultureBaseline ST7 expression/function
Human cancer cell lines (PC3, breast/colon cancer lines)Documented ST7 alterationsTumor suppressor function validation
Human embryonic stem cellsStudy developmental rolesDifferentiation impact studies
  • Genetic modification approaches:

    • CRISPR-Cas9 knockout/knockin for studying endogenous ST7

    • Inducible expression systems for temporal control

    • Fluorescent protein tagging for localization studies

    • Epitope tagging for interaction studies

  • Validation strategies:

    • Compare results across multiple cell types

    • Include both normal and cancer cell models

    • Validate in vivo when possible using xenograft models

When possible, parallel studies in both human and marmoset cells will provide valuable comparative insights into conserved functions.

How can researchers investigate ST7 mutations found in cancer?

ST7 mutations have been identified in various cancers, particularly breast tumors and colon carcinomas . To thoroughly investigate these mutations:

  • Mutation characterization methodology:

    • Targeted sequencing of ST7 in tumor samples

    • Whole exome/genome sequencing to identify novel mutations

    • Copy number variation analysis to detect deletions/amplifications

    • Promoter methylation analysis to assess epigenetic silencing

  • Functional impact assessment:

    • Site-directed mutagenesis to recreate cancer-associated mutations

    • Stable expression of mutant variants in appropriate cell lines

    • Comparison of mutant vs. wild-type activity in tumor suppression assays

    • Structural analysis of mutation effects on protein folding and interactions

  • Clinical correlation studies:

    • Association of ST7 mutation status with patient outcomes

    • Correlation with other molecular features (mutation signatures, pathway alterations)

    • Analysis of mutation patterns across cancer types and subtypes

  • Therapeutic implications:

    • Synthetic lethality screens to identify vulnerabilities in ST7-mutant cells

    • Drug sensitivity profiling based on ST7 mutation status

    • Development of biomarkers for patient stratification

When investigating ST7 mutations, researchers should pay particular attention to the distinction between loss-of-function mutations (typical for tumor suppressors) and potential gain-of-function mutations that might create novel protein activities.

What approaches should be used to study ST7's role in tumor microenvironment interactions?

The observation that ST7 affects in vivo tumorigenicity without altering in vitro proliferation suggests critical interactions with the tumor microenvironment . To investigate these interactions:

  • Co-culture experimental systems:

    • Cancer cells with stromal components (fibroblasts, immune cells, endothelial cells)

    • 3D organotypic models incorporating multiple cell types

    • Microfluidic devices to study dynamic interactions

  • Extracellular matrix (ECM) interactions:

    • Adhesion assays on different ECM components

    • Matrix degradation/remodeling assessment

    • Analysis of integrin signaling in ST7-modulated cells

  • Secretome analysis:

    • Conditioned media profiling from ST7-expressing vs. control cells

    • Cytokine/chemokine array analysis

    • Exosome isolation and characterization

    • Mass spectrometry of secreted proteins

  • In vivo experimental approaches:

    • Immune-competent models when possible

    • Intravital imaging to visualize tumor-stromal interactions

    • Single-cell RNA-seq of tumor and microenvironment components

    • Spatial transcriptomics to map expression patterns

These approaches will help elucidate how ST7 mediates its tumor suppressive effects through modulation of the complex tumor ecosystem rather than direct effects on cancer cell proliferation.

How can post-translational modifications of ST7 be investigated?

Post-translational modifications (PTMs) likely play crucial roles in regulating ST7 function. A comprehensive investigation requires:

  • PTM identification strategies:

    • Mass spectrometry-based proteomics with enrichment for specific modifications

    • Western blotting with modification-specific antibodies

    • Radiolabeling approaches for specific modifications

    • Computational prediction of potential modification sites

  • Key modifications to investigate:

    • Phosphorylation: Affecting activity, localization, and interactions

    • Ubiquitination: Regulating protein stability and turnover

    • SUMOylation: Influencing protein-protein interactions

    • Glycosylation: Potentially affecting secretion or surface presentation

    • Acetylation: Modulating protein activity and DNA binding

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Expression of phosphomimetic or non-phosphorylatable mutants

    • Treatment with inhibitors of specific modification enzymes

    • Analysis of modification dynamics during cell cycle or stress responses

  • Cross-species comparison:

    • Conservation of modification sites between human and Callithrix jacchus

    • Species-specific modifying enzymes

    • Evolutionary analysis of regulatory mechanisms

Understanding ST7's post-translational modifications may reveal novel regulatory mechanisms and potential therapeutic targets for cancers with ST7 alterations.

What are the most promising therapeutic strategies targeting the ST7 pathway?

Developing therapeutic approaches targeting ST7 requires innovative strategies given the challenges of restoring tumor suppressor function:

  • Gene therapy approaches:

    • Viral vectors for ST7 re-expression in deficient tumors

    • CRISPR-based approaches for correcting mutations

    • mRNA delivery systems for transient expression

  • Synthetic lethality strategies:

    • High-throughput screens to identify genes essential in ST7-deficient cells

    • Development of inhibitors targeting synthetic lethal partners

    • Combination therapy approaches exploiting ST7 pathway vulnerabilities

  • Pathway-based approaches:

    • Identification of druggable downstream effectors of ST7

    • Targeting proteins that become dysregulated upon ST7 loss

    • Modulation of interaction partners (e.g., NFKBIA)

  • Biomarker development:

    • ST7 mutation/expression status as predictive biomarker

    • Pathway activation signatures for patient stratification

    • Companion diagnostics for ST7-targeted therapies

How can Callithrix jacchus models advance human ST7 research?

Callithrix jacchus (common marmoset) offers several distinct advantages for translational ST7 research:

  • Evolutionary advantages:

    • Phylogenetic proximity to humans

    • Conservation of key cancer-related pathways

    • Similar tissue architecture and physiology

    • Natural occurrence of spontaneous neoplasms

  • Practical research benefits:

    • Smaller size compared to other primates

    • Shorter lifespan facilitating longitudinal studies

    • Multiple births enabling larger study cohorts

    • Established colonies in many research institutions

  • Methodological applications:

    • Comparative genomics to identify conserved regulatory elements

    • Cross-species validation of molecular mechanisms

    • Pre-clinical testing of therapeutic approaches

    • Development of specialized disease models

  • Translational workflow:

    • Basic mechanistic studies in cell culture systems

    • Validation in marmoset primary cells and tissues

    • In vivo studies in marmoset models

    • Correlation with human clinical data

    • Development of human applications

When utilizing marmoset models, researchers should remain aware of species-specific differences that may affect translation to human applications, while leveraging the significant homology between marmoset and human ST7 proteins.

What considerations are important when developing ST7-based cancer biomarkers?

Development of ST7-based biomarkers for cancer diagnosis, prognosis, or treatment selection requires systematic validation:

  • Biomarker selection criteria:

    • ST7 gene mutations or deletions

    • ST7 protein expression levels

    • Pathway activation signatures

    • Combination with other molecular markers

  • Detection methodology development:

    • Immunohistochemistry protocols for tissue samples

    • ELISA or other protein quantification methods

    • PCR-based mutation detection assays

    • Next-generation sequencing panels including ST7

  • Validation requirements:

    • Analytical validation: Accuracy, precision, sensitivity, specificity

    • Clinical validation: Association with outcomes in multiple cohorts

    • Utility validation: Impact on clinical decision-making

  • Implementation considerations:

    • Sample requirements and preservation methods

    • Turnaround time and cost

    • Integration with existing diagnostic workflows

    • Regulatory approval pathway

Given ST7's role in multiple cancer types, biomarker development should initially focus on cancers with frequent 7q31 alterations, such as breast, colon, and prostate cancers, where the clinical utility may be highest.

What are the key unresolved questions in ST7 research?

Despite significant advances in understanding ST7's role as a tumor suppressor, several critical questions remain unresolved:

  • Mechanistic questions:

    • What are the precise molecular mechanisms by which ST7 suppresses tumorigenicity?

    • How does ST7 interact with the tumor microenvironment to exert its effects?

    • What signaling pathways are directly regulated by ST7?

    • How do post-translational modifications regulate ST7 function?

  • Clinical relevance questions:

    • What is the prognostic significance of ST7 alterations across different cancer types?

    • Can ST7 status predict response to specific therapies?

    • Are there cancer subtypes particularly dependent on ST7 loss?

  • Therapeutic potential questions:

    • Can ST7 function be restored through small molecules or biologics?

    • What synthetic lethal interactions with ST7 loss can be therapeutically exploited?

    • How can our understanding of ST7 inform combination therapy approaches?

  • Evolutionary biology questions:

    • How has ST7 function evolved across primate species?

    • Are there species-specific regulatory mechanisms?

    • What can comparative studies between human and Callithrix jacchus ST7 reveal about tumor suppressor evolution?

Addressing these questions will require integrative approaches combining molecular, cellular, and in vivo studies across species, ultimately advancing both basic science understanding and clinical applications.

What future directions are most promising for ST7 research?

Based on current knowledge and technological capabilities, these research directions offer the most promising advances in ST7 biology:

  • Comprehensive characterization of the ST7 interactome:

    • Proteomic identification of all interaction partners

    • Mapping of interaction domains and interfaces

    • Temporal dynamics of interactions under different conditions

    • Cross-species conservation of interaction networks

  • CRISPR-based functional genomics:

    • Genome-wide synthetic lethality screens in ST7-deficient backgrounds

    • CRISPRa/CRISPRi screens to identify regulators of ST7 expression

    • Base editing approaches for precise modification of ST7

    • In vivo CRISPR screens in appropriate animal models

  • Single-cell multi-omics approaches:

    • Single-cell transcriptomics in tumors with ST7 alterations

    • Spatial transcriptomics to understand microenvironment interactions

    • Integrated analysis of genomic, transcriptomic, and proteomic data

    • Temporal dynamics of ST7-mediated processes

  • Translational applications:

    • Development of ST7 pathway-targeted therapeutics

    • Clinical validation of ST7 as a biomarker

    • Patient stratification strategies based on ST7 status

    • Combination therapy approaches targeting vulnerabilities in ST7-deficient cancers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.