Recombinant Calloselasma rhodostoma NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Calloselasma rhodostoma MT-ND4

NADH-Ubiquinone Oxidoreductase Chain 4 (MT-ND4) is a critical component of the mitochondrial respiratory chain Complex I, playing a fundamental role in cellular energy production through electron transport and oxidative phosphorylation. The recombinant form of this protein from Calloselasma rhodostoma is produced through genetic engineering techniques, where the gene encoding MT-ND4 is isolated, cloned, and expressed in suitable host organisms, typically Escherichia coli bacterial expression systems . The resulting protein product can be used for various research applications, including structural studies, functional analyses, and potentially diagnostic tools development.

The MT-ND4 gene is encoded in the mitochondrial genome and has an enzyme classification number (EC) of 1.6.5.3, identifying it as part of the oxidoreductase family that acts on NADH or NADPH with quinones or similar compounds as electron acceptors . This mitochondrial gene has proven valuable in phylogenetic studies of snake species, particularly for understanding evolutionary relationships within venomous snake populations across Southeast Asia .

Calloselasma rhodostoma: The Malayan Pit Viper

Calloselasma rhodostoma, commonly known as the Malayan pit viper, is a medically significant venomous snake found throughout Southeast Asia. This species inhabits lowland forests and palm plantations across its range, which includes Thailand, Indonesia, and neighboring countries . As a member of the Viperidae family and Crotalinae subfamily, it possesses specialized heat-sensing pits between the eye and nostril, characteristic of pit vipers.

The Malayan pit viper is known for its potent hematotoxic venom, which can cause severe bleeding disorders in envenomation victims. Clinical manifestations include coagulopathy, thrombocytopenia, and systemic bleeding, with local effects such as swelling and pain at the bite site . The venom contains several bioactive components, including rhodostoxin, a major hemorrhagin with proteolytic and hemorrhagic activities .

MT-ND4 in Snake Biology and Evolution

In its natural context, the MT-ND4 protein functions as part of the electron transport chain in mitochondria, contributing to ATP synthesis—the primary energy currency of cells. The gene encoding this protein has been utilized extensively in phylogenetic studies of Calloselasma rhodostoma, providing insights into the species' geographical distribution and evolutionary history.

Research using the MT-ND4 gene has revealed that Calloselasma rhodostoma populations likely spread throughout Southeast Asia during the Pleistocene period, with estimated origin in Java around 1.8 million years ago. Subsequent divergence events include spread to Kalimantan approximately 1.2 million years ago, with later dispersal to Thailand and Kangean. The separation of Thailand and Kangean populations is estimated to have occurred around 0.8 million years ago . These findings demonstrate the value of MT-ND4 as a genetic marker for evolutionary studies in snake populations.

Recombinant Expression Methodology

The recombinant production of Calloselasma rhodostoma MT-ND4 primarily utilizes Escherichia coli expression systems . This bacterial platform offers advantages including simplified genetic manipulation, rapid growth, and high protein yields. The production process typically involves gene isolation, vector construction, bacterial transformation, expression induction, and subsequent purification steps.

For commercial preparations, the MT-ND4 gene sequence (either full-length or partial) is typically cloned into expression vectors containing appropriate regulatory elements and fusion tag sequences. After transformation into E. coli host cells, protein expression is induced under optimized conditions, followed by bacterial harvesting and protein extraction procedures.

Purification and Quality Control

The purification of recombinant MT-ND4 leverages the incorporated fusion tags, particularly the N-terminal histidine tag, which enables affinity chromatography purification methods. This approach allows for selective binding of the tagged protein to metal chelation resins, with subsequent elution steps to obtain purified protein.

Quality control assessments for commercial preparations typically include SDS-PAGE analysis to evaluate purity and molecular weight confirmation. Available recombinant products demonstrate high purity levels, reported as greater than 90% for some preparations and greater than 85% for others, as determined by SDS-PAGE analysis .

The final product is often provided in lyophilized (freeze-dried) form to enhance stability during shipping and storage. This process involves freezing the protein solution and removing water under vacuum conditions, resulting in a powder that requires reconstitution before use .

Phylogenetic and Evolutionary Studies

A primary application of MT-ND4 is in phylogenetic analysis and evolutionary studies of snake populations. The MT-ND4 gene has been instrumental in elucidating the evolutionary history and geographical distribution patterns of Calloselasma rhodostoma across Southeast Asia . These studies have provided insights into population divergence events during the Pleistocene period, contributing to our understanding of snake biogeography in the region.

Mitochondrial genes like MT-ND4 are particularly valuable for such studies due to their maternal inheritance pattern, lack of recombination, and relatively constant evolutionary rate. These characteristics make them suitable molecular markers for tracing evolutionary lineages and estimating divergence times between populations.

Laboratory and Research Applications

Recombinant Calloselasma rhodostoma MT-ND4 serves various laboratory functions, with specific applications including:

  1. SDS-PAGE analysis for protein characterization and molecular weight determination

  2. Potential use as antigens for antibody production

  3. Comparative biochemical studies of mitochondrial proteins across snake species

  4. Structural and functional investigations of respiratory chain components

The availability of purified recombinant protein facilitates these research applications, providing standardized material for consistent experimental outcomes. While specific functional studies using this recombinant protein are not extensively documented in the available literature, its potential contributions to understanding snake mitochondrial biology and evolution are significant.

Reconstitution Protocol

Commercial lyophilized preparations of recombinant MT-ND4 require reconstitution before use. The recommended procedure involves:

  1. Briefly centrifuging the vial before opening to ensure the lyophilized powder is collected at the bottom

  2. Reconstituting in deionized sterile water to achieve a protein concentration of 0.1-1.0 mg/mL

  3. Adding glycerol to a final concentration of 5-50% (with 50% being a commonly recommended value)

  4. Creating multiple small aliquots for long-term storage to minimize freeze-thaw cycles

This reconstitution protocol helps maintain protein stability and ensures consistent performance in downstream applications. The addition of glycerol serves as a cryoprotectant, reducing protein denaturation during freezing and thawing processes.

Integration with Venom Research

While MT-ND4 itself is not a venom component, future research could explore potential connections between mitochondrial function and venom production in Calloselasma rhodostoma. Venom gland cells have high metabolic demands associated with toxin synthesis, suggesting a possible specialized role for mitochondrial proteins like MT-ND4 in these tissues.

Comparative studies examining MT-ND4 expression or activity in venom gland tissues versus other tissues could potentially reveal adaptations related to the energetic requirements of venom production. Such investigations would complement the extensive body of research on Calloselasma rhodostoma venom components, which includes well-characterized proteins like rhodostoxin, a hemorrhagic metalloproteinase with significant clinical relevance .

Expanded Phylogenetic Applications

Future research directions could include expanded phylogenetic analyses incorporating MT-ND4 sequences from broader geographical collections of Calloselasma rhodostoma. Such studies could further refine our understanding of this species' population structure, migration patterns, and evolutionary history across Southeast Asia.

The existing research has already established valuable insights into divergence events during the Pleistocene period , but additional sampling could potentially reveal more nuanced patterns of genetic diversity and geographic distribution. These findings would contribute not only to our knowledge of snake evolution but also to broader biogeographical patterns in Southeast Asian fauna.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQIMPTTKTDMFLPLVVLALWGAVLANLTCLQQTDLK SLIAYSSISHMGLVAAAIIIQTPWGLSGGMTLMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMATTWWLLTNLMNIATPPTTNFTSELLIMSALFNWCPTTIIMLGLSMLIT ASYSLHMFLSTQMGPPPSNNLTEPSHSREHLLMILHIMPLLMISLKSELII
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered essential for the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4 and what role does it play in mitochondrial function?

MT-ND4 (mitochondrially encoded NADH dehydrogenase 4) is a core subunit of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. It functions in the transfer of electrons from NADH to ubiquinone, which is a critical step in the process of oxidative phosphorylation and cellular energy production. MT-ND4 is believed to be part of the minimal assembly required for the catalytic activity of Complex I . The protein is encoded by the mitochondrial genome rather than the nuclear genome, making it unique among many cellular proteins. MT-ND4 contains multiple transmembrane regions (11 according to some analyses) and is embedded within the inner mitochondrial membrane, where it participates in proton pumping across the membrane to generate the electrochemical gradient necessary for ATP synthesis .

The specific function of MT-ND4 involves accepting electrons from NADH and transferring them through the respiratory chain. Deficiencies or mutations in this protein can lead to significant mitochondrial dysfunction, increased reactive oxygen species (ROS) generation, and have been implicated in various human diseases including Leber hereditary optic neuropathy (LHON) . Understanding the structure and function of MT-ND4 across different species, including Calloselasma rhodostoma, provides valuable insights into mitochondrial evolution and species-specific adaptations in energy metabolism.

How does the amino acid sequence of Calloselasma rhodostoma MT-ND4 compare to human MT-ND4?

When analyzing the amino acid sequence of MT-ND4 across species, researchers should employ comparative sequence alignment tools such as MUSCLE, CLUSTAL, or BLAST to identify conserved regions and species-specific variations. The human MT-ND4 consists of 459 amino acid residues with a molecular weight of approximately 51.6 kDa and a theoretical pI of 9.67 . While specific sequence data for Calloselasma rhodostoma MT-ND4 is not provided in the search results, researchers should focus on key functional domains that are likely conserved across species.

Methodology for comparative sequence analysis should include:

  • Multiple sequence alignment of MT-ND4 from various species including reptiles (particularly venomous snakes), mammals, and other vertebrates

  • Identification of conserved domains, particularly those involved in NADH binding and electron transport

  • Analysis of transmembrane regions using prediction tools such as TMHMM or Phobius

  • Phylogenetic analysis to understand evolutionary relationships

The human MT-ND4 contains multiple transmembrane regions and functional domains critical for Complex I assembly and activity . Researchers should pay particular attention to these domains when comparing sequences across species, as they likely represent evolutionarily conserved functional regions. Species-specific variations outside these conserved domains may reflect adaptations to different physiological demands or environmental conditions.

What are the key structural features that distinguish MT-ND4 from other components of Complex I?

MT-ND4 is distinguished from other Complex I components by several key structural characteristics that directly relate to its function. The protein contains multiple transmembrane regions (11 have been identified in human MT-ND4) that anchor it within the inner mitochondrial membrane . These transmembrane domains form part of the proton-pumping apparatus of Complex I, contributing to the generation of the proton gradient necessary for ATP synthesis.

To study these structural features, researchers should employ:

  • Protein structure prediction tools to generate theoretical models of the protein's tertiary structure

  • Hydropathy plot analysis to confirm transmembrane regions

  • Molecular dynamics simulations to understand protein behavior within the membrane environment

The protein's location within the membrane portion of Complex I positions it optimally for its role in electron transport and proton pumping. Unlike nuclear-encoded subunits of Complex I, MT-ND4 must be imported into the mitochondria following translation, which involves specialized transport mechanisms . Researchers investigating Calloselasma rhodostoma MT-ND4 should note that while the general structural organization is likely conserved with human MT-ND4, species-specific variations may exist, particularly in regions not directly involved in electron transport or proton pumping.

What are the optimal expression systems for producing recombinant Calloselasma rhodostoma MT-ND4?

The expression of recombinant mitochondrial membrane proteins like MT-ND4 presents significant challenges due to their hydrophobicity, complex folding requirements, and potential toxicity to host cells. Based on available data and experience with similar proteins, researchers should consider several expression systems:

  • Wheat germ cell-free expression system: This system has been successfully used for human MT-ND4 expression and offers advantages for membrane proteins as it bypasses potential toxicity issues associated with overexpression in cellular systems. The cell-free approach allows for direct incorporation of the protein into liposomes or nanodiscs to maintain proper folding.

  • Specialized E. coli strains: For bacterial expression, strains such as C41(DE3) or C43(DE3), which are designed for toxic membrane protein expression, may be utilized with codon-optimization of the MT-ND4 sequence for E. coli.

  • Baculovirus-insect cell system: This eukaryotic system can provide better post-translational modifications and membrane protein folding compared to bacterial systems.

  • Mammalian expression systems: For functional studies requiring proper assembly into Complex I, mammalian expression systems combined with allotopic expression strategies may be appropriate .

The methodology should include optimization of expression conditions (temperature, induction parameters, media composition) and the addition of solubilizing agents or fusion partners (such as MBP, SUMO, or TrxA) to enhance solubility. For Calloselasma rhodostoma MT-ND4, researchers should consider species-specific codon optimization and potential requirements for proper folding that might differ from human MT-ND4.

What purification strategies yield the highest purity and activity for recombinant MT-ND4?

Purification of recombinant MT-ND4 requires specialized approaches due to its highly hydrophobic nature as a membrane protein. A comprehensive purification strategy should include:

  • Detergent selection: Screen multiple detergents (e.g., DDM, LMNG, digitonin) for optimal solubilization while maintaining protein structure and function. The choice of detergent is critical for maintaining the native conformational state of MT-ND4.

  • Affinity chromatography: Utilize fusion tags such as His6, FLAG, or Strep-tag for initial capture. Based on commercial recombinant MT-ND4 preparations, proprietary purification methods are often employed .

  • Size exclusion chromatography: This step helps separate properly folded protein from aggregates and can provide information about the oligomeric state of the protein.

  • Ion exchange chromatography: Given the basic pI of human MT-ND4 (9.67) , cation exchange chromatography may be effective for further purification.

The buffer system should be carefully optimized, typically containing:

  • 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

  • 100-300 mM NaCl

  • 5-10% glycerol

  • Selected detergent at concentrations above its critical micelle concentration

  • Potentially reducing agents such as glutathione or DTT to prevent oxidation

Researchers should implement activity assays throughout the purification process to ensure that the purified protein maintains its functional properties. For MT-ND4, this could include NADH dehydrogenase activity assays or reconstitution experiments to assess electron transport capability.

How can researchers assess the proper folding and activity of recombinant MT-ND4?

Assessing proper folding and activity of recombinant MT-ND4 requires multiple complementary approaches:

  • Spectroscopic methods: Circular dichroism (CD) spectroscopy can provide information about secondary structure content. For MT-ND4, the expected predominance of alpha-helical transmembrane domains should be reflected in characteristic CD spectra.

  • Activity assays: NADH:ubiquinone oxidoreductase activity can be measured using artificial electron acceptors such as ferricyanide or more physiologically relevant ubiquinone analogues. These assays typically monitor the rate of NADH oxidation spectrophotometrically at 340 nm.

  • Reconstitution experiments: Incorporating purified MT-ND4 into liposomes or nanodiscs and assessing proton pumping activity using pH-sensitive fluorescent dyes can confirm functional integrity.

  • Thermal stability assays: Techniques such as differential scanning fluorimetry (DSF) or thermal shift assays can assess protein stability and proper folding.

  • Structural validation: While challenging for membrane proteins, limited proteolysis followed by mass spectrometry can provide information about accessible regions and proper folding.

For the specific case of Calloselasma rhodostoma MT-ND4, researchers should develop species-specific antibodies or utilize epitope tags for detection in immunoassays . Comparison with native Complex I activity from mitochondrial preparations can serve as a reference point for assessing recombinant protein functionality. Researchers might also consider allotopic expression approaches as used for human ND4, where the protein is expressed from a nuclear gene but targeted to mitochondria, to assess functional integration into Complex I .

What are the most effective methods for studying MT-ND4 mutations and their functional consequences?

Studying MT-ND4 mutations requires a multi-faceted approach that combines molecular, cellular, and biochemical techniques:

  • Site-directed mutagenesis: Generate specific mutations in recombinant MT-ND4 constructs, focusing on conserved residues or regions implicated in human diseases such as Leber hereditary optic neuropathy (LHON) . This approach allows for systematic analysis of structure-function relationships.

  • Allotopic expression systems: For functional studies in cellular contexts, researchers can utilize optimized allotopic expression where nuclear-encoded MT-ND4 (with or without mutations) is targeted to mitochondria. This approach has been successful for human ND4 studies and could be adapted for Calloselasma rhodostoma MT-ND4 . The methodology involves:

    • Design of expression constructs containing MT-ND4 coding sequence with appropriate mitochondrial targeting sequences

    • Addition of cis-acting elements (such as the 3'UTR of COX10 mRNA) to enhance mitochondrial targeting and translation efficiency

    • Verification of mitochondrial localization using immunofluorescence microscopy with appropriate antibodies or epitope tags

  • Respiratory chain complex activity assays: Measure Complex I activity in the presence of wild-type versus mutant MT-ND4 using standardized biochemical assays. These typically assess electron transfer from NADH to ubiquinone and can be performed in isolated mitochondria, submitochondrial particles, or with purified complexes.

  • ROS production analysis: Mutations in MT-ND4 often lead to increased reactive oxygen species generation, which can be quantified using fluorescent probes such as DCF-DA or MitoSOX .

  • Mitochondrial morphology and ultrastructure analysis: Electron microscopy can reveal changes in mitochondrial structure associated with MT-ND4 dysfunction, such as altered cristae morphology .

Research has shown that mutations in Complex I subunits, including MT-ND4, can lead to significant mitochondrial dysfunction with increased oxidative stress and ultrastructural impairment of mitochondria . For researchers working with Calloselasma rhodostoma MT-ND4, comparative studies with human MT-ND4 mutations could provide insights into conserved functional domains and species-specific adaptations.

How can researchers effectively incorporate MT-ND4 into proteoliposomes for functional studies?

Reconstitution of MT-ND4 into proteoliposomes is a powerful approach for studying its function in a controlled membrane environment. The methodology involves several critical steps:

  • Lipid selection and preparation:

    • Use a mixture of phospholipids that mimics the composition of the inner mitochondrial membrane (e.g., a combination of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin)

    • Prepare unilamellar liposomes of defined size using extrusion or sonication methods

  • Protein incorporation:

    • Detergent-mediated reconstitution: Mix purified MT-ND4 in detergent with preformed liposomes, followed by controlled detergent removal via dialysis or using adsorbent beads (Bio-Beads)

    • Direct incorporation during liposome formation: Include the protein during the lipid film hydration step

  • Verification of incorporation:

    • Density gradient centrifugation to separate protein-containing liposomes from free protein

    • Freeze-fracture electron microscopy to visualize protein distribution within the membrane

    • Protease protection assays to confirm proper orientation

  • Functional assays:

    • Measure proton pumping using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine)

    • Assess electron transport using fluorescent or spectrophotometric techniques

    • Monitor membrane potential changes using potential-sensitive dyes like DiSC3(5)

For complex functional studies, researchers might consider co-reconstitution of MT-ND4 with other Complex I subunits or even the entire complex. The lipid-to-protein ratio should be optimized (typically ranging from 20:1 to 100:1 by weight) to ensure proper protein density within the membrane while maintaining liposome stability.

When working specifically with Calloselasma rhodostoma MT-ND4, researchers should consider potential species-specific requirements for lipid composition or buffer conditions that might optimize protein function based on the snake's physiology or evolutionary adaptations.

What techniques are most effective for studying the assembly of MT-ND4 into Complex I?

Investigating the assembly of MT-ND4 into Complex I requires specialized techniques that can track this complex process. Based on current research methodologies, the following approaches are recommended:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • This technique separates intact protein complexes and can identify Complex I assembly intermediates

    • Combined with second-dimension SDS-PAGE, it allows identification of specific subunits (including MT-ND4) within these intermediates

    • Western blotting with antibodies against MT-ND4 or epitope tags can confirm its presence in different assembly stages

  • Pulse-chase experiments with labeled amino acids:

    • Track the incorporation of newly synthesized MT-ND4 into Complex I over time

    • Can be combined with immunoprecipitation to isolate specific complexes

  • Proximity labeling techniques:

    • APEX2 or BioID fused to MT-ND4 can identify neighboring proteins during the assembly process

    • Helps establish the temporal sequence of protein-protein interactions during Complex I biogenesis

  • Fluorescence microscopy with tagged proteins:

    • Fluorescently tagged MT-ND4 can be tracked in living cells to monitor its incorporation into mitochondria and assembly into Complex I

    • As demonstrated in research with human ND4, antibodies against epitope tags (such as HA1) can be used to visualize the protein's localization within mitochondria

  • Cryo-electron microscopy:

    • Provides structural insights into Complex I assembly intermediates containing MT-ND4

    • Can reveal conformational changes associated with the incorporation of MT-ND4

Research has shown that proper assembly of Complex I is critical for mitochondrial function, and disruptions in this process can lead to significant dysfunction and disease . For Calloselasma rhodostoma MT-ND4, comparative studies with human or other mammalian systems could highlight conserved assembly pathways or species-specific variations in this process.

How does MT-ND4 from venomous snakes like Calloselasma rhodostoma differ from other species in structure and function?

Comparative analysis of MT-ND4 across species provides valuable insights into evolutionary adaptations and functional conservation. While specific data on Calloselasma rhodostoma MT-ND4 is not provided in the search results, researchers can employ the following methodological approach to investigate species differences:

  • Sequence-based analysis:

    • Multiple sequence alignment of MT-ND4 from venomous snakes (including Calloselasma rhodostoma), non-venomous snakes, other reptiles, and mammals

    • Calculation of conservation scores for each amino acid position

    • Identification of snake-specific or venom-producing species-specific substitutions

    • Analysis of selection pressure using dN/dS ratios to identify positively selected residues

  • Structural modeling and comparison:

    • Generate homology models based on known structures of Complex I

    • Compare predicted structural features, particularly transmembrane domains and functional regions

    • Analyze the potential impact of species-specific variations on protein stability, interaction surfaces, and functional properties

  • Functional comparative studies:

    • Express recombinant MT-ND4 from different species and compare biochemical properties

    • Assess species-specific differences in NADH dehydrogenase activity, oxygen reactivity, or sensitivity to inhibitors

    • Investigate potential adaptations related to the metabolic demands of venom production

The human MT-ND4 contains 459 amino acids with multiple transmembrane domains and specific functional regions involved in NADH dehydrogenase activity . Venomous snakes like Calloselasma rhodostoma may exhibit adaptations in MT-ND4 related to their unique metabolic requirements, including the energetically demanding process of venom production. Such adaptations might be reflected in altered electron transport efficiency, different responses to oxidative stress, or modified interactions with other Complex I subunits.

What insights can comparative analysis of MT-ND4 provide about mitochondrial evolution across species?

Comparative analysis of MT-ND4 across diverse species offers a window into mitochondrial evolution and adaptation. Researchers investigating this area should implement the following methodology:

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on MT-ND4 sequences from diverse taxonomic groups

    • Compare MT-ND4 evolution with other mitochondrial and nuclear genes to identify potential cases of co-evolution

    • Assess evolutionary rates and patterns of selection across different lineages

  • Analysis of conserved domains and motifs:

    • Identify universally conserved regions likely essential for basic function

    • Map species-specific variations to particular functional domains

    • Correlate conserved regions with structural elements identified in cryo-EM studies of Complex I

  • Correlation with ecological and physiological parameters:

    • Analyze whether variations in MT-ND4 correlate with metabolic rate, environmental temperature, or other physiological parameters

    • For venomous species like Calloselasma rhodostoma, investigate potential correlations with venom composition or toxicity

  • Mitochondrial disease-associated mutations:

    • Compare disease-causing mutations in human MT-ND4 (such as those causing LHON) with natural variations in other species

    • Identify potentially compensatory mechanisms in species that naturally carry amino acids that would be pathogenic in humans

The human MT-ND4 protein plays critical roles in the assembly and activity of Complex I, and its dysfunction has been implicated in various diseases . Comparative analysis of MT-ND4 from Calloselasma rhodostoma and other species can reveal how this essential protein has evolved different properties while maintaining its core function in cellular energy production. Such analysis might identify natural variations that could inform therapeutic approaches for human mitochondrial diseases or provide insights into the evolution of energy metabolism in different lineages.

How can researchers leverage MT-ND4 sequence data for species identification and phylogenetic studies?

MT-ND4 has proven valuable as a molecular marker for species identification and phylogenetic studies, particularly in reptiles including snakes. Researchers can utilize the following methodological approach:

  • DNA barcoding and species identification:

    • Design universal primers targeting conserved regions flanking variable segments of MT-ND4

    • Develop standardized PCR and sequencing protocols for consistent data generation

    • Establish reference databases of MT-ND4 sequences from authenticated specimens

    • Implement statistical methods to define species boundaries based on sequence divergence

  • Phylogenetic reconstruction methodology:

    • Select appropriate evolutionary models based on likelihood ratio tests

    • Employ multiple phylogenetic inference methods (Maximum Likelihood, Bayesian Inference, Neighbor-Joining) to ensure robust results

    • Implement bootstrap analysis or posterior probability calculation to assess node support

    • Consider combining MT-ND4 data with other genetic markers for multilocus phylogenies

  • Population genetics applications:

    • Analyze intraspecific variation in MT-ND4 to assess population structure

    • Use haplotype networks to visualize relationships among closely related populations

    • Estimate genetic diversity parameters and test for signatures of selection or demographic changes

  • Forensic applications:

    • Develop MT-ND4-based assays for identifying snake species in cases of envenomation

    • Establish protocols for species identification from degraded samples (shed skins, venom residue)

MT-ND4 is particularly useful for phylogenetic studies due to its moderate evolutionary rate, which provides sufficient variation for resolving relationships at various taxonomic levels. For venomous snakes like Calloselasma rhodostoma, MT-ND4 sequence data can help resolve taxonomic uncertainties, identify cryptic species, and contribute to our understanding of the evolution of venom systems. The combination of conserved regions for primer binding and variable regions for phylogenetic signal makes MT-ND4 an excellent marker for evolutionary studies across different taxonomic scales.

What are the most common technical challenges in recombinant MT-ND4 research and how can they be overcome?

Research with recombinant MT-ND4 presents several technical challenges due to its nature as a highly hydrophobic mitochondrial membrane protein. Based on experiences with similar proteins, the following challenges and solutions are recommended:

  • Expression and solubility issues:

    • Challenge: Low expression levels and protein aggregation

    • Solution: Optimize expression using specialized systems such as wheat germ cell-free expression , adjust growth temperature (typically lower temperatures of 16-20°C), use solubility-enhancing fusion tags (MBP, SUMO), and screen multiple detergents for solubilization

  • Proper folding and activity:

    • Challenge: Ensuring the recombinant protein adopts native conformation

    • Solution: Implement the "optimized allotopic expression" approach where specific elements (such as the 3'UTR of COX10 mRNA) are included to enhance mitochondrial targeting and proper integration

  • Mitochondrial targeting and import:

    • Challenge: Efficient delivery of recombinant MT-ND4 to mitochondria for functional studies

    • Solution: Design constructs with appropriate mitochondrial targeting signals and use visualization techniques (such as immunofluorescence with anti-HA antibodies) to confirm localization

  • Stability during purification:

    • Challenge: Maintaining protein stability throughout purification

    • Solution: Include stabilizing agents such as glycerol, optimize buffer composition (including glutathione as a reducing agent ), and minimize exposure to elevated temperatures

  • Functional assessment:

    • Challenge: Confirming activity of the recombinant protein

    • Solution: Develop robust activity assays, consider co-expression with interacting partners, or reconstitution into liposomes for functional studies

For specific work with Calloselasma rhodostoma MT-ND4, researchers should consider species-specific codon optimization for the expression system of choice and potentially develop customized antibodies for detection and localization studies. Pilot experiments comparing different expression and purification strategies are essential before scaling up production.

How can researchers differentiate between the effects of MT-ND4 dysfunction and other mitochondrial protein deficiencies?

Distinguishing MT-ND4 dysfunction from other mitochondrial defects requires a comprehensive approach with specific assays targeted at Complex I function. The recommended methodology includes:

  • Specific Complex I activity assays:

    • Measure NADH:ubiquinone oxidoreductase activity using isolated mitochondria or purified complexes

    • Compare results with activities of other respiratory chain complexes (II, III, IV, V) to identify Complex I-specific defects

    • Use specific Complex I inhibitors (rotenone, piericidin A) as controls

  • Subunit-specific approaches:

    • Use gene editing (CRISPR/Cas9) or RNA interference to selectively target MT-ND4

    • Compare phenotypes with those resulting from deficiencies in other Complex I subunits

    • Employ rescue experiments with wild-type MT-ND4 to confirm specificity of observed defects

  • Assembly analysis:

    • Use Blue Native PAGE to assess Complex I assembly

    • Identify specific assembly intermediates that accumulate in MT-ND4 deficiency

    • Compare with patterns seen in deficiencies of other Complex I subunits

  • Functional and structural analyses:

    • Measure ROS production, which is often increased in Complex I deficiencies

    • Assess mitochondrial membrane potential using fluorescent probes

    • Analyze mitochondrial ultrastructure using electron microscopy, looking for specific changes in cristae morphology associated with MT-ND4 deficiency

  • Molecular dynamics under stress conditions:

    • Compare responses to various stressors (high NaCl, LPS) between MT-ND4-deficient models and other mitochondrial defects

    • Test the effects of antioxidants like resveratrol, which has been shown to counteract ROS generation in some mitochondrial disorders

Research has demonstrated that deficiency in different respiratory chain components can produce distinct patterns of dysfunction. For example, studies with fibroblasts from heterozygous Ndufc2 knock-out rats showed specific patterns of mitochondrial dysfunction that could be distinguished from other defects . By implementing this comprehensive approach, researchers can confidently attribute observed phenotypes specifically to MT-ND4 dysfunction rather than general mitochondrial defects.

What are the best approaches for studying interactions between MT-ND4 and other Complex I subunits?

Investigating protein-protein interactions involving MT-ND4 within Complex I requires specialized techniques suitable for membrane proteins. The following methodological approaches are recommended:

  • Crosslinking coupled with mass spectrometry:

    • Use chemical crosslinkers with various spacer lengths to capture interactions

    • Analyze crosslinked peptides using specialized mass spectrometry workflows

    • Map interaction sites to structural models of Complex I

  • Co-immunoprecipitation with epitope-tagged proteins:

    • Express MT-ND4 with epitope tags (such as the HA1 tag used in human studies )

    • Use gentle detergent solubilization to maintain protein-protein interactions

    • Identify interacting partners using mass spectrometry or Western blotting

  • Proximity labeling techniques:

    • Express MT-ND4 fused to enzymes such as APEX2 or BioID

    • These enzymes biotinylate proteins in close proximity when activated

    • Identify biotinylated proteins using streptavidin pulldown followed by mass spectrometry

  • Genetic interaction screens:

    • Systematically combine mutations in MT-ND4 with mutations in other Complex I subunits

    • Analyze synthetic lethality or suppressor effects to infer functional relationships

  • Structural biology approaches:

    • Use cryo-electron microscopy to visualize the position of MT-ND4 within Complex I

    • Analyze the structure of subcomplexes or assembly intermediates

    • Employ computational molecular dynamics to predict interaction interfaces

The implementation of these techniques should be guided by the current understanding of Complex I structure. Human MT-ND4 has been characterized as a core subunit of Complex I that is involved in the minimal assembly required for catalysis . Studies have shown that MT-ND4, when expressed as a recombinant protein, can be successfully incorporated into mitochondria and assembled into Complex I . For Calloselasma rhodostoma MT-ND4, researchers should adapt these approaches based on any known species-specific characteristics of the protein or the respiratory chain in reptilian mitochondria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.