Recombinant Calomys laucha NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its role in cellular respiration?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein subunit encoded by the mitochondrial genome that serves as an essential component of Complex I (NADH dehydrogenase) in the electron transport chain. This protein contributes to the core structure of the largest respiratory complex in the mitochondrial inner membrane . Functionally, MT-ND4L participates in the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane, which generates the electrochemical gradient necessary for ATP synthesis .

The protein is highly hydrophobic and forms part of the transmembrane domain of Complex I, which displays an L-shaped structure with a hydrophobic domain embedded in the membrane and a hydrophilic peripheral arm containing the redox centers and NADH binding site . MT-ND4L's extreme biochemical properties, particularly its hydrophobicity, often make it challenging to detect using standard proteomic approaches .

What are the structural characteristics of Calomys laucha MT-ND4L?

Calomys laucha MT-ND4L is a small protein consisting of 98 amino acids with a molecular weight of approximately 11 kDa . The complete amino acid sequence is:

MTQASTNILLAFFFSLLGTLIFRSHLLMSTLLCLEGMLTLFIMSTMLTALNSWSTVMYTIPIVMLVFAACEAAIGLALLAMJSNTYGHDYVQNLNLLQC

This protein is highly hydrophobic, containing multiple transmembrane domains that anchor it within the mitochondrial inner membrane. Like other mitochondrially-encoded Complex I subunits, MT-ND4L is characterized by its extreme hydrophobicity, which contributes to the core structure of the transmembrane region of Complex I .

How is the MT-ND4L gene organized in the mitochondrial genome?

The MT-ND4L gene is located in the mitochondrial DNA. In humans, it spans from base pair 10,469 to 10,765 . A particularly interesting feature of the MT-ND4L gene is its unusual overlap with the MT-ND4 gene. Specifically, the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Glutamine, Cysteine, and Stop) overlap with the first three codons of MT-ND4 (5'-ATG CTA AAA-3' coding for Methionine-Leucine-Lysine) .

This 7-nucleotide gene overlap creates an interesting reading frame shift where, with respect to the MT-ND4L reading frame (+1), the MT-ND4 gene starts in the +3 reading frame:
[CAA][TGC][TAA]AA versus CA[ATG][CTA][AAA] .

While the specific details of the Calomys laucha MT-ND4L gene organization are not explicitly provided in the search results, mitochondrial gene organization tends to be relatively conserved among mammals.

What methodological challenges are associated with studying MT-ND4L and how can they be overcome?

MT-ND4L presents several significant methodological challenges that researchers must address:

• Detection difficulties: Due to its extreme biochemical properties, particularly its high hydrophobicity, MT-ND4L often cannot be detected using standard proteomic approaches . When characterizing Complex I from plants, researchers noted that while ND4L was present, it could not be detected by the procedures employed due to these properties .

• Purification challenges: The hydrophobic nature of MT-ND4L makes it difficult to purify without disrupting its native structure or function.

• Expression challenges: Recombinant expression of highly hydrophobic membrane proteins often results in protein aggregation or inclusion body formation.

Methodological solutions include:

• Specialized detergents and solubilization protocols: Using specific detergents optimized for highly hydrophobic proteins can improve extraction efficiency.

• Recombinant protein production: As evidenced by the availability of recombinant Calomys laucha MT-ND4L , optimized expression systems can overcome some challenges. The storage buffer for such recombinant proteins typically includes Tris-based buffer with 50% glycerol to maintain stability .

• Advanced structural biology techniques: Techniques like cryo-electron microscopy may be more suitable than crystallography for studying membrane-embedded components of Complex I.

• AI-driven approaches: Modern research on MT-ND4L has employed AI algorithms to predict alternative functional states, including large-scale conformational changes, and to identify binding pockets on the protein's surface .

How can evolutionary analysis of MT-ND4L contribute to understanding phylogenetic relationships among rodent species?

MT-ND4L, as a mitochondrially encoded gene, offers several advantages for phylogenetic analysis:

• Maternal inheritance: Mitochondrial genes are maternally inherited without recombination, providing a clearer evolutionary signal than nuclear genes.

• Evolutionary rate: Mitochondrial genes often evolve at a faster rate than nuclear genes, making them useful for resolving relationships among closely related species.

• Conservation of function: The essential role of MT-ND4L in cellular respiration means that functional constraints influence its evolution, potentially providing signals about adaptive changes.

For rodent phylogeny specifically, researchers studying the genus Calomys have used mitochondrial DNA sequence data (though focusing on cytochrome b rather than ND4L) to propose relationships among species and to understand evolutionary patterns . The analyses showed that Calomys is constituted by two major clades, one primarily associated with mountain habitats that subsequently invaded lowland habitats, and another with species restricted to lowland habitats both north and south of the Amazon basin .

Similar approaches could be applied using MT-ND4L sequences, potentially in combination with other mitochondrial and nuclear markers, to further resolve phylogenetic relationships within Sigmodontinae rodents including Calomys laucha.

What functional assays can be used to characterize the activity of recombinant MT-ND4L in experimental settings?

Several functional assays can be employed to characterize recombinant MT-ND4L activity:

• Complex I activity assays: Measuring NADH:ubiquinone oxidoreductase activity using spectrophotometric methods that track the rate of NADH oxidation.

• Reconstitution experiments: Incorporating recombinant MT-ND4L into membrane-mimetic systems (liposomes or nanodiscs) and measuring proton pumping activity.

• Binding studies: Assessing interactions between MT-ND4L and other Complex I subunits using techniques like surface plasmon resonance or isothermal titration calorimetry.

• Mutational analysis: Introducing site-specific mutations to identify critical residues for function.

• Structural stabilization studies: Evaluating how MT-ND4L contributes to the structural integrity of Complex I using thermal shift assays or limited proteolysis.

For recombinant Calomys laucha MT-ND4L specifically, proper storage conditions (at -20°C, or -80°C for extended storage, with working aliquots at 4°C for up to one week) are crucial for maintaining functional integrity . Additionally, repeated freezing and thawing should be avoided to prevent protein degradation .

What protein expression systems are optimal for producing recombinant MT-ND4L?

The optimal expression system for recombinant MT-ND4L production depends on experimental objectives and downstream applications. Several approaches can be considered:

• Bacterial expression systems: While E. coli is the most common expression host, the high hydrophobicity of MT-ND4L often leads to inclusion body formation. Modified strains like C41(DE3) or C43(DE3), specifically designed for membrane protein expression, can improve yield and solubility.

• Cell-free expression systems: These can be advantageous for highly hydrophobic proteins as they allow immediate incorporation into supplied detergent micelles or liposomes.

• Eukaryotic expression systems: Yeast (S. cerevisiae or P. pastoris), insect cells (using baculovirus expression vectors), or mammalian cells provide more native-like folding environments that may better accommodate the unique structural requirements of MT-ND4L.

For commercially available recombinant Calomys laucha MT-ND4L, the expression region encompasses amino acids 1-98, representing the full-length protein . The tag type is determined during the production process based on optimal expression and purification outcomes .

How can AI-driven approaches enhance research on MT-ND4L structure and function?

AI-driven approaches offer powerful new tools for studying complex proteins like MT-ND4L:

• Literature research integration: Custom-tailored Language Learning Models (LLMs) can extract and formalize relevant information about MT-ND4L from structured and unstructured data sources, storing it in a Knowledge Graph format. This comprehensive analysis provides insights into therapeutic significance, small molecule ligands, relevant off-targets, and protein-protein interactions .

• Conformational ensemble generation: Advanced AI algorithms can predict alternative functional states of MT-ND4L, including large-scale conformational changes. Through AI-enhanced molecular simulations and trajectory clustering, researchers can explore the protein's conformational space and identify representative structures .

• Binding pocket identification: AI-based pocket prediction modules can discover orthosteric, allosteric, hidden, and cryptic binding pockets on the protein's surface. This technique integrates literature-driven insights with structure-aware ensemble-based pocket detection algorithms that leverage established protein dynamics .

These AI approaches are particularly valuable for challenging proteins like MT-ND4L, where experimental methods face limitations due to the protein's hydrophobicity and membrane association.

What purification strategies yield the highest purity and activity for recombinant MT-ND4L?

Purification of recombinant MT-ND4L requires specialized approaches due to its hydrophobic nature:

• Detergent selection: The choice of detergent is critical. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often provide a good balance between efficient solubilization and preservation of native structure.

• Affinity chromatography: Fusion tags (His, FLAG, Strep) facilitate initial purification, though the specific tag type should be determined during the production process to optimize for the particular protein's characteristics .

• Size exclusion chromatography: This technique helps separate properly folded protein from aggregates and removes excess detergent.

• Buffer optimization: For recombinant Calomys laucha MT-ND4L, a Tris-based buffer with 50% glycerol has been found to optimize protein stability .

• Storage conditions: Store at -20°C for general use or -80°C for extended storage, with working aliquots maintained at 4°C for up to one week. Repeated freezing and thawing should be avoided .

This methodological approach ensures that the purified recombinant MT-ND4L maintains its structural integrity and functional activity for subsequent experimental applications.

How does MT-ND4L from Calomys laucha compare with other species in structure and function?

Comparative analysis of MT-ND4L across species provides insights into evolutionary conservation and functional adaptation:

• Sequence conservation: While specific comparative data for Calomys laucha MT-ND4L is limited in the search results, mitochondrial proteins generally show evolutionary constraints due to their essential functions. The 98-amino acid sequence of Calomys laucha MT-ND4L can be compared with other species to identify conserved functional domains and species-specific variations.

• Structural similarities: MT-ND4L is consistently one of the most hydrophobic subunits of Complex I across species, forming part of the core transmembrane region . This structural role appears to be conserved from mammals to plants, though the specific membrane-spanning topology may vary.

• Functional conservation: As part of NADH dehydrogenase (Complex I), MT-ND4L contributes to electron transport and energy production across species. The enzyme classification (EC 1.6.5.3) is consistent across taxonomic groups .

• Evolutionary context: In rodent evolution studies, mitochondrial genes have been used to understand phylogenetic relationships. For example, analysis of the genus Calomys revealed two major evolutionary clades associated with different habitat adaptations . Such evolutionary patterns may correlate with functional adaptations in mitochondrial proteins.

A comprehensive comparative analysis would require alignment of MT-ND4L sequences from multiple species, assessment of conservation patterns, and correlation with functional studies across taxonomic groups.

What role does MT-ND4L play in mitochondrial disease models?

MT-ND4L has significant implications for understanding mitochondrial diseases:

• Disease associations: Variants of human MT-ND4L are associated with increased BMI in adults and Leber's Hereditary Optic Neuropathy (LHON) . These associations highlight the protein's importance in normal mitochondrial function and energy metabolism.

• Model systems: While not specifically mentioned for Calomys laucha MT-ND4L, recombinant forms of this protein could potentially serve as valuable tools for studying the biochemical basis of mitochondrial diseases. Comparative studies between normal and disease-associated variants could illuminate pathogenic mechanisms.

• Therapeutic implications: Research platforms like Receptor.AI have identified NADH-ubiquinone oxidoreductase chain 4L as a prospective target with high therapeutic potential , suggesting that understanding its structure and function could lead to novel therapeutic approaches for mitochondrial diseases.

• Complex I dysfunction models: As a critical component of Complex I, MT-ND4L dysfunction contributes to broader respiratory chain defects. Recombinant proteins could be used in reconstitution experiments to study how specific mutations affect complex assembly and function.

Given the conservation of mitochondrial function across species, studies using recombinant Calomys laucha MT-ND4L could provide comparative insights that inform human mitochondrial disease research.