Recombinant Calomys musculinus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a synthetic protein derived from the mitochondrial genome of the drylands vesper mouse (Calomys musculinus). This subunit is a critical component of Complex I (NADH dehydrogenase) in the mitochondrial electron transport chain, facilitating electron transfer from NADH to ubiquinone and proton pumping across the inner mitochondrial membrane .
Function: Core subunit in Complex I’s transmembrane domain, essential for maintaining redox balance and ATP synthesis .
The recombinant MT-ND4L protein retains the structural hallmarks of the native protein:
Hydrophobic Regions: Forms the transmembrane core of Complex I, contributing to its stability in the mitochondrial inner membrane .
Gene Overlap: Shares a 7-nucleotide overlap with the MT-ND4 gene, a feature conserved across species .
Amino Acid Sequence (Partial):
MTQASTNILLAFFFSLLGTLIFRSHLMSTLLCLEGMMLTLFIMSTMTALNSQSTVMYTIP IVMLVFAACEAAIGLALLAMISNTYGTDYVQNLNLLQC .
MT-ND4L is indispensable for Complex I’s catalytic activity:
Electron Transfer: Participates in the initial steps of electron transport, passing electrons from NADH to FMN and Fe-S clusters .
Proton Pumping: Conformational changes during electron transfer drive proton translocation, generating the proton gradient for ATP synthesis .
The Calomys musculinus MT-ND4L is synthesized via recombinant DNA technology, with details inferred from commercial suppliers :
Note: The expression system (e.g., bacterial, mammalian) is not disclosed in available data .
Recombinant MT-ND4L is utilized in:
ELISA Assays: For studying antibody interactions or protein quantification .
Complex I Assembly Studies: Investigating subunit interactions and dysfunction linked to mitochondrial disorders .
Drug Discovery: Screening inhibitors targeting Complex I or mitochondrial diseases .
While the Calomys musculinus MT-ND4L has not been directly implicated in disease models, homologous mutations in human MT-ND4L (e.g., Val65Ala) are linked to:
Leber Hereditary Optic Neuropathy (LHON): Disrupted Complex I activity reduces ATP production, selectively affecting optic nerve cells .
Metabolic Disorders: Variants correlate with obesity, diabetes, and hypertension due to impaired oxidative phosphorylation .
A comparison of recombinant MT-ND4L proteins highlights species-specific differences:
Stability: Repeated freeze-thaw cycles degrade recombinant MT-ND4L, necessitating aliquoting .
Functional Validation: Limited data on enzymatic activity of the Calomys variant compared to human homologs .
Species-Specific Insights: Studies on Calomys musculinus MT-ND4L could elucidate evolutionary conservation of Complex I subunits or disease mechanisms .
MT-ND4L (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4L) is a protein-coding gene that produces NADH dehydrogenase 4L, a component of Complex I in the mitochondrial respiratory chain. This protein plays a crucial role in the first step of the electron transport process during oxidative phosphorylation. Specifically, it participates in transferring electrons from NADH to ubiquinone, which is essential for creating the electrochemical gradient that drives ATP production . The protein is embedded in the inner mitochondrial membrane where it contributes to maintaining the membrane potential necessary for energy generation. MT-ND4L functions within a larger multi-subunit complex that serves as the primary entry point for electrons into the respiratory chain, making it fundamental to cellular energy metabolism in eukaryotes .
The amino acid sequence of MT-ND4L in Calomys laucha consists of 98 amino acids: MTQASTNILLAFFFSLLGTLIFRSH-LMSTLLCLEGMMLTLFIMSTMTALNQSTVMYTIPIPVMLVFAACEAAIGLA-LLAMISNTYGDYVQNLNLLQC . This sequence reveals several structural characteristics typical of mitochondrial membrane proteins, including multiple hydrophobic regions that facilitate membrane integration. The protein contains transmembrane domains that anchor it within the inner mitochondrial membrane. These domains are rich in amino acids like leucine, isoleucine, and phenylalanine, which contribute to hydrophobicity and membrane stability . The full-length protein spans positions 1-98 in the expression region, with no post-translational modifications noted in the available data. This sequence information is crucial for researchers designing experiments involving protein expression, purification, or structural analysis of MT-ND4L from Calomys species .
Recombinant MT-ND4L requires specific storage conditions to maintain protein stability and functionality. The recommended storage buffer consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein . For long-term storage, the protein should be kept at -20°C, while extended storage periods warrant conservation at -20°C or -80°C to prevent degradation . When working with the protein, it's advisable to store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles. Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity . When preparing experiments, researchers should thaw aliquots on ice and centrifuge briefly before opening the tube to ensure all material is collected at the bottom. For optimal results in functional assays, the protein should be used immediately after thawing and kept on ice throughout the experimental procedure to preserve enzymatic activity.
When conducting literature searches or database queries for MT-ND4L, researchers should be aware of several nomenclature variants. The officially recommended name is "NADH-ubiquinone oxidoreductase chain 4L" with the EC number 1.6.5.3 . Common alternative names include "NADH dehydrogenase subunit 4L," which is frequently used in metabolic studies . For gene notation, multiple synonyms exist including "MT-ND4L" (the standard gene symbol), "MTND4L," "NADH4L," and "ND4L" . These variations are important to consider when performing comprehensive literature reviews or database searches. The UniProt accession number for Calomys laucha MT-ND4L is O21783, which provides a unique identifier for cross-database referencing . When publishing research, it's recommended to include these alternative designations to ensure proper indexing and to facilitate integration with existing literature on this mitochondrial protein.
Advanced methodologies for studying MT-ND4L conformational dynamics require integrated computational and experimental approaches. AI-driven conformational ensemble generation has emerged as a particularly powerful technique, employing algorithms that predict alternative functional states including large-scale changes along collective coordinates . Molecular simulations with AI-enhanced sampling and trajectory clustering have proven effective for exploring the broad conformational space of MT-ND4L and identifying representative structures . These computational approaches should be complemented with experimental techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) to validate predicted conformational shifts. For high-resolution structural analysis, researchers can employ cryo-electron microscopy of the entire Complex I, as traditional X-ray crystallography is challenging due to MT-ND4L's hydrophobicity and membrane integration . Diffusion-based AI models and active learning AutoML have demonstrated success in generating statistically robust ensembles of equilibrium protein conformations that capture MT-ND4L's full dynamic behavior, providing a foundation for structure-based drug design .
Recombination events play a significant role in MT-ND4L evolution, with recent research identifying it as one of only three mitochondrial genes (along with ND1 and ND2) particularly prone to recombination . In a comprehensive study of mitochondrial genes, recombination analysis revealed specific recombination events within ND4L at positions 157-243 bp, with evidence of major and minor parental contributions from different species . These recombination events contribute to genetic diversity and may affect functional properties of the protein. The biological significance of these recombination events may relate to adaptive pressures on mitochondrial function in different ecological niches. Methodologically, researchers studying recombination in MT-ND4L should employ multiple detection methods including RDP, GENECONV, BOOTSCAN, MAXCHI, CHIMAERA, SISCAN, and 3SEQ as implemented in software packages like RDP4, with analysis carried out using a standard setting with a Bonferroni corrected P-value cut-off of 0.05 .
Selection pressure analysis of MT-ND4L reveals evidence of both negative selection and episodic diversifying selection acting on this gene. To quantify these selection pressures, researchers should calculate nonsynonymous (dN) and synonymous (dS) substitution values using computational approaches such as those available through the Datamonkey server with the Hyphy package . The Single Likelihood Ancestor Counting (SLAC) method is effective for estimating positive or negative selection patterns, while the Mixed Model of Evolution (MEME) is particularly useful for identifying episodic diversifying selection at specific sites . Studies have identified episodic selection affecting multiple codons in mitochondrial genes, with ND4L showing evidence of specific selective events . The biological interpretation of these selection patterns likely reflects the functional constraints on MT-ND4L as a core component of Complex I, with negative selection predominating to maintain critical protein function while episodic selection may relate to adaptation to changing environmental or metabolic demands across evolutionary time.
AI-driven approaches have revolutionized binding pocket identification for MT-ND4L, enabling the discovery of orthosteric, allosteric, hidden, and cryptic binding sites that may be leveraged for therapeutic development. State-of-the-art methodologies integrate LLM-powered literature research with structure-aware ensemble-based pocket detection algorithms that utilize established protein dynamics data . This comprehensive approach begins with a foundational knowledge graph constructed from structured and unstructured data sources, providing insights into MT-ND4L's therapeutic significance, existing ligands, relevant off-targets, and protein-protein interactions . The computational pipeline combines multiple AI techniques, with tentative pockets subjected to AI scoring and ranking while simultaneously detecting functional attributes that may be pharmacologically relevant . For experimental validation of these computationally predicted pockets, researchers should employ techniques such as site-directed mutagenesis followed by functional assays to confirm the importance of specific residues. This integrated AI-experimental approach offers significant advantages over traditional methods, particularly for challenging membrane proteins like MT-ND4L, by identifying novel druggable sites that might otherwise remain undetected.
Mutations in MT-ND4L have significant implications for mitochondrial disease research, particularly in relation to Leber hereditary optic neuropathy (LHON). A specific mutation, T10663C (Val65Ala), which changes the amino acid valine to alanine at position 65, has been identified in several families with LHON . This single amino acid substitution in the NADH dehydrogenase 4L protein appears to contribute to the vision loss characteristic of this condition, though the precise pathogenic mechanism remains incompletely understood . Research methodologies for investigating such mutations should include comprehensive genetic screening, functional assays of Complex I activity, measurements of ROS production, and assessment of cellular ATP levels in patient-derived cells or model systems. Beyond LHON, researchers should consider potential contributions of MT-ND4L variants to other mitochondriopathies characterized by Complex I dysfunction. The development of animal models carrying specific MT-ND4L mutations would significantly advance our understanding of the pathophysiological mechanisms and potential therapeutic interventions for these mitochondrial disorders.
Codon usage analysis of MT-ND4L reveals distinct patterns that influence expression efficiency in different host systems. Studies examining the persistence of G and C at the 3rd position of codons (a key indicator of base composition bias) have identified specific nucleotide preferences within MT-ND4L . For quantitative assessment of codon bias, researchers calculate Relative Synonymous Codon Usage (RSCU) values, where a value of 1 indicates no bias, >1.0 indicates positive codon usage bias (abundant codons), and <1.0 indicates negative codon usage bias (less abundant codons) . The effective number of codons (ENC) and Codon Adaptation Index (CAI) provide further metrics for analyzing expression efficiency potential. When designing expression systems for recombinant MT-ND4L production, researchers should consider these codon preferences and potentially optimize codons for the selected expression host. Tools such as the CAIcal server can assist in calculating these metrics and optimizing expression constructs . This codon optimization approach is particularly important when expressing mitochondrial genes like MT-ND4L in bacterial or yeast systems, as significant differences in codon preferences between organellar and cytosolic translation machineries can dramatically impact recombinant protein yields.
Purification of recombinant MT-ND4L presents significant challenges due to its hydrophobic nature and membrane integration. An optimal protocol begins with expression in a suitable system such as bacterial (E. coli) or eukaryotic (insect or mammalian) cells with appropriate codon optimization. For extraction, a gentle solubilization approach using non-ionic detergents like n-dodecyl β-D-maltoside (DDM) or digitonin is recommended to maintain native protein folding . Following initial extraction, affinity chromatography utilizing an appropriate tag (determined during the production process) provides the first purification step . Subsequent size exclusion chromatography removes aggregates and further purifies the protein. Throughout the purification process, maintenance of a stable buffer system is critical, with the recommended Tris-based buffer containing 50% glycerol proving effective for preserving protein stability . Quality control steps should include SDS-PAGE analysis, western blotting for identity confirmation, and functional assays such as NADH:ubiquinone oxidoreductase activity measurements to verify that the purified protein maintains catalytic function. Final preparations should be stored in aliquots at -20°C or -80°C to prevent degradation from repeated freeze-thaw cycles .
Designing experiments to study MT-ND4L interactions within Complex I requires a multi-faceted approach combining structural, biochemical, and computational methods. Cross-linking mass spectrometry (XL-MS) represents a powerful technique for mapping protein-protein interactions, utilizing spacer-arm reagents that covalently link proximal amino acid residues followed by mass spectrometric identification of linked peptides. For higher resolution structural analysis, researchers should consider cryo-electron microscopy of purified Complex I, which can reveal detailed interaction interfaces of MT-ND4L with adjacent subunits. Functional validation of identified interactions can be achieved through site-directed mutagenesis of key interface residues followed by assembly and activity assays. The AI-driven conformational ensemble analysis mentioned previously provides valuable computational insights into dynamic interaction surfaces . Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of MT-ND4L with altered solvent accessibility when assembled in Complex I versus in isolation, revealing interaction surfaces. For live-cell studies of Complex I assembly, techniques such as proximity ligation assays or split fluorescent protein complementation can visualize MT-ND4L incorporation into the complex and identify factors affecting this process.
Analysis of recombination events in MT-ND4L requires robust computational and statistical approaches. Researchers should implement multiple recombination detection methods including RDP, GENECONV, BOOTSCAN, MAXCHI, CHIMAERA, SISCAN, and 3SEQ, all available within software packages such as RDP4 . Analysis parameters should include standard settings with a Bonferroni corrected P-value cut-off of 0.05 to minimize false positives . Prior to recombination analysis, high-quality sequence alignment of MT-ND4L genes from multiple species is essential, with careful attention to ensuring correct reading frames. For comprehensive evolutionary insights, researchers should identify potential recombinant sequences as well as major and minor parent sequences, as exemplified in studies showing recombination events in MT-ND4L at positions 157-243 bp with identifiable parental contributions . Phylogenetic network analysis can complement these methods by visualizing complex evolutionary relationships that may not be apparent in bifurcating trees. For experimental validation of computationally predicted recombination events, researchers might design ancestral sequence reconstruction experiments followed by functional characterization of reconstructed proteins to assess the phenotypic impact of historical recombination events in MT-ND4L.
Comparing MT-ND4L across rodent species requires integrated sequence and functional analysis approaches. For sequence comparisons, researchers should align MT-ND4L amino acid sequences from multiple rodent species, particularly focusing on the Calomys genus and related rodents. Conservation analysis tools like ConSurf can identify highly conserved residues likely crucial for function versus variable regions that may relate to species-specific adaptations. Structural modeling using the known MT-ND4L sequence from Calomys laucha (MTQASTNILLAFFFSLLGTLIFRSH-LMSTLLCLEGMMLTLFIMSTMTALNQSTVMYTIPIPVMLVFAACEAAIGLA-LLAMISNTYGDYVQNLNLLQC) can provide a template for mapping conservation patterns in three dimensions . For functional comparisons, researchers should consider recombinant expression of MT-ND4L from different species followed by enzymatic activity assays measuring NADH:ubiquinone oxidoreductase activity. Complementation studies in cell lines with MT-ND4L deficiencies can assess functional equivalence between orthologs. Respirometry measurements using cells expressing different MT-ND4L variants can provide insights into functional conservation of mitochondrial respiration efficiency. These approaches together can reveal both sequence and functional evolution of MT-ND4L across rodent phylogeny.
When faced with contradictory data regarding MT-ND4L structure or function, researchers should implement a systematic approach to data reconciliation. First, a comprehensive meta-analysis of published studies should be conducted, carefully documenting methodological differences that might explain discrepancies, including protein preparation methods, experimental conditions, and analytical techniques. Researchers should then design critical experiments specifically targeting these contradictions, ensuring methodological rigor through appropriate controls, statistical power, and blinding where applicable. Collaborative cross-laboratory validation studies can strengthen confidence in results. AI-driven literature analysis can be particularly valuable in this context, as it can formalize information from diverse sources into knowledge graphs that highlight contradictions and potential explanations . When publishing results addressing contradictory data, researchers should explicitly acknowledge existing contradictions in the literature, provide detailed methodological information to enable reproduction, present results with appropriate statistical analysis and effect sizes, and discuss possible explanations for observed discrepancies. This approach ensures transparency and advances scientific understanding of MT-ND4L despite initial contradictory findings.
Several emerging technologies hold significant promise for advancing MT-ND4L research. Cryo-electron tomography (cryo-ET) offers potential for visualizing MT-ND4L within intact mitochondrial membranes, providing insights into native conformations impossible with traditional structural approaches. Single-molecule FRET techniques could reveal dynamic conformational changes during electron transport, addressing existing limitations in understanding MT-ND4L function in real-time. CRISPR-mediated precise genome editing of mitochondrial DNA, though still developing, could enable creation of model systems with specific MT-ND4L variants to study function in vivo . AI-driven approaches show particular promise, with diffusion-based AI models and active learning AutoML demonstrating capability to generate robust models of protein conformational dynamics that can reveal hidden functional states . Computational developments in AI-based binding pocket prediction represent another frontier, with integrated workflows that combine literature mining with structure-aware algorithms to discover potential drug targets . Advances in nanopore sequencing technologies may facilitate direct detection of MT-ND4L transcripts and their modifications without amplification bias. Together, these emerging technologies address current limitations in structural understanding, functional characterization, and therapeutic targeting of MT-ND4L.