Recombinant Calycanthus floridus var. glaucus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPELKEKMGNLSFQSYRPNKRNILVVGPVPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS RIVRKEKGGYEISIADASDGRQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what role does it play in photosynthetic organisms?

Apocytochrome f (petA) is a critical component of the cytochrome b6-f complex in photosynthetic organisms, facilitating electron transfer between photosystem II and photosystem I. This protein serves as an essential link in the photosynthetic electron transport chain, enabling the conversion of light energy to chemical energy. The recombinant version from Calycanthus floridus var. glaucus is specifically engineered for research applications focused on understanding these fundamental processes.

The functional significance of Apocytochrome f lies in its unique structural motifs that enable electron transfer. These include conserved regions such as "YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV" which contain amino acid sequences critical for heme binding and electron transport functionality .

To properly study this protein, researchers should consider its role within the broader photosynthetic apparatus, particularly its interactions with plastocyanin and its contribution to establishing the proton gradient necessary for ATP synthesis.

What is the taxonomic classification of Calycanthus floridus var. glaucus and how does it differ from the nominal variety?

Calycanthus floridus var. glaucus belongs to the family Calycanthaceae within the following taxonomic hierarchy:

Taxonomic LevelClassification
KingdomPlantae
CladeMagnoliids
OrderLaurales
FamilyCalycanthaceae
GenusCalycanthus
SpeciesC. floridus
Varietyvar. glaucus

This variety has several synonyms, including Calycanthus fertilis var. ferax . The basionym is Calycanthus glaucus Willdenow Enum. Pl., 559. 1809 .

Calycanthus floridus var. glaucus differs from the nominal variety (var. floridus) primarily in its pubescence patterns. The var. glaucus has glabrous (hairless) or sparsely hairy twigs, petioles, and leaf undersides, while var. floridus has distinctly pubescent (hairy) structures . This distinction is important for researchers sourcing plant material, as it may affect protein expression profiles and subsequent recombinant protein characteristics.

The variety is endemic to the southeastern United States, with distribution across Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, Ohio, Pennsylvania, South Carolina, Tennessee, Virginia, and West Virginia . In Kentucky, it holds a conservation status of S2 (State Rank) and T (Threatened) , which may affect collection permits for research purposes.

What are the optimal storage and handling conditions for recombinant Calycanthus floridus var. glaucus Apocytochrome f?

For optimal preservation of protein integrity and activity, researchers should store recombinant Apocytochrome f under the following conditions:

ParameterRecommended Condition
Short-term storage4°C for up to one week
Long-term storage-20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerol
Freeze-thaw cyclesMinimize; not recommended
Working aliquotsStore at 4°C

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain stability . When designing experiments, researchers should consider that repeated freeze-thaw cycles can significantly degrade protein quality and experimental reproducibility.

For experiments requiring extended use, prepare small working aliquots to minimize freeze-thaw cycles. Importantly, when transitioning from frozen storage to experimental conditions, allow the protein to thaw gradually on ice rather than at room temperature to prevent denaturation and preserve functional integrity.

What experimental approaches are recommended for investigating cytochrome b6-f complex dynamics using this recombinant protein?

For researchers investigating cytochrome b6-f complex dynamics, several methodological approaches can be employed using recombinant Apocytochrome f:

  • Electron Transfer Kinetics Studies:

    • Utilize fast kinetic techniques such as stopped-flow spectroscopy or laser flash photolysis

    • Monitor electron transfer rates using absorption changes at characteristic wavelengths (e.g., 554 nm for cytochrome f)

    • Compare wild-type recombinant protein with site-directed mutants to identify critical residues

  • Protein-Protein Interaction Analysis:

    • Employ surface plasmon resonance (SPR) to quantify binding kinetics with partner proteins

    • Use isothermal titration calorimetry (ITC) to determine thermodynamic parameters

    • Perform co-immunoprecipitation studies with other components of the photosynthetic apparatus

  • Structural Studies:

    • Conduct X-ray crystallography or cryo-electron microscopy to resolve protein structure

    • Implement hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • Apply molecular dynamics simulations to predict functional movements during electron transfer

When designing these experiments, researchers should consider using appropriate control proteins and standardized buffer conditions to ensure comparability with published literature. Additionally, integrating multiple complementary techniques will provide more robust insights into complex dynamics.

How does the structure and function of Calycanthus floridus var. glaucus Apocytochrome f compare to that from model photosynthetic organisms?

Comparative analysis of Apocytochrome f from different photosynthetic organisms reveals important evolutionary adaptations and functional conservation:

OrganismSequence HomologyFunctional DifferencesStructural Adaptations
Calycanthus floridus var. glaucusReferenceReferenceReference
Spinacia oleracea (Spinach)~85%Similar electron transfer ratesMinor differences in surface loops
Chlamydomonas reinhardtii~75%Adapted to aquatic environmentMore flexible plastocyanin docking site
Synechocystis sp.~65%Faster turnover rateDifferent surface charge distribution

The Calycanthus floridus var. glaucus Apocytochrome f contains several distinctive sequence motifs that influence its interaction with other proteins in the electron transport chain. These include specific residues in the heme-binding pocket and unique surface features that facilitate plastocyanin docking.

To experimentally investigate these comparative aspects, researchers can employ:

  • Chimeric protein constructs to identify domain-specific functional differences

  • Site-directed mutagenesis to convert key residues to those found in other species

  • Cross-species interaction assays to determine binding specificity

  • Computational modeling to predict structural impacts of sequence variations

Understanding these differences provides valuable insights into evolutionary adaptation of photosynthetic mechanisms across diverse plant lineages.

What are the challenges and optimized protocols for heterologous expression of recombinant Apocytochrome f?

Heterologous expression of recombinant Apocytochrome f presents several technical challenges that researchers must address:

  • Codon Optimization Strategies:

    • Analyze codon usage bias in the expression host

    • Optimize rare codons while maintaining key regulatory elements

    • Balance GC content to prevent secondary structure formation in mRNA

  • Expression System Selection:

    • Yeast systems (particularly Pichia pastoris) have proven effective for this protein

    • Bacterial systems require careful consideration of membrane targeting

    • Plant-based expression systems may provide more authentic post-translational modifications

  • Solubility Enhancement Approaches:

    • Fusion tags (MBP, SUMO, or Thioredoxin) can improve solubility

    • Co-expression with chaperones may facilitate proper folding

    • Temperature optimization during induction (typically 16-18°C) reduces inclusion body formation

  • Purification Strategy Optimization:

    • Multiple chromatography steps are typically required:
      a. Initial capture via affinity chromatography
      b. Intermediate purification via ion exchange
      c. Polishing via size exclusion chromatography

    • Buffer composition requires optimization to maintain heme incorporation

When implementing these strategies, researchers should monitor protein quality at each step using techniques such as circular dichroism to assess secondary structure, and functional assays to confirm electron transfer capability.

How can site-directed mutagenesis of recombinant Apocytochrome f be used to investigate electron transfer pathways?

Site-directed mutagenesis provides a powerful approach to dissect electron transfer mechanisms in Apocytochrome f:

  • Key Residues for Targeted Mutation:

    • Heme-coordinating histidines (crucial for electron acceptance/donation)

    • Surface-exposed residues in the plastocyanin docking region

    • Conserved residues in putative electron transfer pathways

    • Membrane-anchoring domains

  • Recommended Mutation Strategies:

    • Conservative substitutions (e.g., His→Asn) to assess specific chemical properties

    • Charge-reversal mutations to investigate electrostatic interactions

    • Alanine-scanning to identify functionally critical residues

    • Introduction of spectroscopic probes (e.g., Trp) for monitoring conformational changes

  • Functional Assessment Methods:

    • Measure electron transfer rates using stopped-flow spectroscopy

    • Determine redox potentials via potentiometric titrations

    • Assess binding kinetics with partner proteins using SPR

    • Perform in vitro reconstitution with other components of the electron transport chain

By systematically mutating specific residues and characterizing the resulting functional changes, researchers can construct a detailed map of electron transfer pathways and identify rate-limiting steps in the process. This approach has revealed that electron transfer in Apocytochrome f involves both through-bond and through-space mechanisms, with specific pathways depending on protein conformation.

What methodological approaches are recommended for integrating recombinant Apocytochrome f into artificial photosynthetic systems?

The integration of recombinant Apocytochrome f into artificial photosynthetic systems represents an advanced research direction with significant potential for sustainable energy applications:

  • Protein Immobilization Strategies:

    • Covalent attachment to functionalized electrodes via engineered cysteine residues

    • Oriented immobilization using His-tags and Ni-NTA modified surfaces

    • Entrapment in biomimetic membranes or polymer matrices

    • Self-assembled monolayers with specific protein-binding domains

  • System Design Considerations:

    • Incorporate appropriate electron donors and acceptors to complete electron transfer chains

    • Optimize spatial arrangement to facilitate efficient electron tunneling

    • Design interfaces that mimic natural membrane environments

    • Include stabilizing agents to maintain long-term functionality

  • Performance Evaluation Methods:

    • Electrochemical techniques (cyclic voltammetry, chronoamperometry)

    • Time-resolved spectroscopy to monitor electron transfer events

    • Quantum yield measurements for light-driven processes

    • Stability testing under various environmental conditions

Researchers should consider that the partial sequence (amino acids 36-320) used in the recombinant protein lacks the native membrane-spanning domain , which may necessitate alternative anchoring strategies or the use of surfactants to maintain proper orientation and function in artificial systems.

How does the photosynthetic efficiency of Calycanthus floridus var. glaucus relate to its Apocytochrome f characteristics?

Understanding the relationship between Apocytochrome f characteristics and photosynthetic efficiency in Calycanthus floridus var. glaucus provides insights into evolutionary adaptations and potential biotechnological applications:

  • Habitat-Specific Adaptations:

    • Calycanthus floridus var. glaucus thrives in deciduous or mixed woodlands, along streams and rivers, and at woodland margins

    • The plant grows at elevations from 0-1850 m across southeastern United States

    • These diverse habitats may have selected for specific Apocytochrome f properties that optimize photosynthetic performance under variable light conditions

  • Comparative Analysis Methodology:

    • Measure electron transport rates in isolated thylakoids from different varieties

    • Compare oxygen evolution rates under standardized conditions

    • Analyze P700 reduction kinetics following plastoquinol oxidation

    • Conduct chlorophyll fluorescence measurements to assess PSII-PSI electron flow

  • Research Findings and Implications:

    • The glabrous nature of var. glaucus leaves may affect light penetration and consequently photosynthetic efficiency

    • The specific amino acid sequence of Apocytochrome f from this variety exhibits adaptations that potentially optimize electron transfer under the plant's native light conditions

    • Understanding these adaptations could inform the design of enhanced photosynthetic systems for agricultural or biotechnological applications

Researchers investigating these relationships should employ a multidisciplinary approach combining molecular biology, biochemistry, and ecophysiology to establish meaningful correlations between protein characteristics and whole-plant performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.