Recombinant Calycanthus floridus var. glaucus ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Table 1: Biophysical and Biochemical Properties

PropertyDetails
Molecular Weight~27 kDa (predicted)
Amino Acid SequenceMNVLPCSINTLKGLYDISEVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAAIAVRN... (247 aa)
Secondary StructurePredicted transmembrane helices (residues 1–132)
Purity>90% (SDS-PAGE verified)
Storage ConditionsLyophilized at -20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)

The protein’s sequence aligns with chloroplast-localized ATP synthase subunits, featuring conserved proton-channeling domains critical for F₀ sector assembly .

Functional Role in Chloroplast ATP Synthase

ATP synthase in chloroplasts comprises CF₀ (membrane-bound) and CF₁ (stromal) sectors. The atpI subunit is integral to CF₀, forming part of the proton-conducting channel. Key functions include:

  • Proton Translocation: Facilitates H⁺ flow from thylakoid lumen to stroma, coupling proton motive force to ATP synthesis .

  • Structural Stabilization: Interacts with other CF₀ subunits (e.g., atpB, atpE) to maintain complex integrity .

Comparative genomic studies reveal atpI’s conservation across angiosperms, with Calycanthus floridus var. glaucus exhibiting unique codon usage biases and RNA editing sites that optimize photosynthetic efficiency .

Expression and Purification

  • Host System: E. coli BL21(DE3) or similar strains .

  • Tag System: His tag enables affinity chromatography (Ni-NTA) .

  • Yield: ~0.1–1.0 mg/mL post-reconstitution .

Research Applications

  • Enzyme Kinetics: Used to study proton transport kinetics and ATP synthase inhibition mechanisms .

  • Structural Biology: Crystallization trials for resolving CF₀ architecture .

  • Plant Biotechnology: Serves as a template for engineering stress-tolerant crops with enhanced photosynthetic output .

Comparative Genomic Insights

Chloroplast genome analyses of Calycanthus floridus var. glaucus highlight evolutionary adaptations in ATP synthase subunits:

Table 2: atpI Gene Features in Magnoliidae Clade

SpeciesIR Region Length (bp)atpI Exon/Intron StructureRNA Editing Sites
C. floridus var. glaucus25,632Single exon (no introns)8
Aristolochia debilis26,239Exon I (145 bp), Intron I (805 bp)12
Piper cenocladum26,255Exon I (152 bp), Intron I (780 bp)10

These variations correlate with species-specific adaptations to light intensity and nutrient availability .

Future Research Directions

  • Mechanistic Studies: Elucidate atpI’s role in proton-channel gating using cryo-EM .

  • Biotechnological Engineering: Overexpress atpI in model plants to assess photosynthetic efficiency under abiotic stress .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing the order, and we will fulfill it accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
atpI
Target Protein Sequence
MNVLPCSINTLKGLYDISEVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAAIAVRN PQTIPTDGQNFFEYVLEFIRDLTKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPRKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpI) and what is its role in the ATP synthase complex?

ATP synthase subunit a (atpI) is a critical component of the F₀ sector of the ATP synthase complex. It plays an essential role in proton translocation across the membrane, which drives the synthesis of ATP. The subunit a forms part of the stator assembly that contains the proton channel through which H⁺ ions flow down their electrochemical gradient . This proton flow drives the rotation of the c-ring, which is ultimately coupled to the conformational changes in F₁ that catalyze ATP synthesis. Specifically in Calycanthus floridus var. glaucus, the subunit a (atpI) is a 247 amino acid protein located in the chloroplast membrane .

What are the recommended storage and handling conditions for Recombinant Calycanthus floridus var. glaucus ATP synthase subunit a?

For optimal preservation of enzymatic activity, Recombinant Calycanthus floridus var. glaucus ATP synthase subunit a should be stored at -20°C, and for extended storage periods, conservation at -80°C is recommended . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which helps maintain stability. To prevent protein degradation, repeated freeze-thaw cycles should be strictly avoided . For ongoing experiments, working aliquots can be stored at 4°C for up to one week. Prior to experimentation, the protein should be thawed slowly on ice to maintain structural integrity and functionality.

What methodological approaches are recommended for studying pH-dependent conformational changes in ATP synthase?

Recent studies have revealed that ATP synthase exhibits unique conformational states under acidic conditions, which has significant implications for understanding its function in hypoxic environments. To investigate pH-dependent conformational changes in ATP synthase, researchers should consider the following methodological approaches:

  • Cryo-electron microscopy (cryo-EM): This technique has been successfully used to capture distinct conformational states of ATP synthase at different pH levels. When studying Calycanthus floridus var. glaucus ATP synthase, sample preparation should maintain the protein in its native lipid environment to preserve physiologically relevant conformations .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can provide detailed information about protein dynamics and solvent accessibility changes in response to pH variations. The method is particularly valuable for monitoring conformational changes in large protein complexes like ATP synthase.

  • Fluorescence resonance energy transfer (FRET): By strategically labeling different subunits of the ATP synthase complex, researchers can monitor distance changes between these subunits as a function of pH, providing insights into conformational dynamics.

  • Biochemical activity assays under controlled pH conditions: When performing these assays with Calycanthus floridus var. glaucus ATP synthase, it's critical to establish a pH range from neutral (pH 7.0) to acidic (approximately pH 6.0) to capture the full spectrum of conformational and functional changes .

Research has shown that at acidic pH, ATP synthase adopts at least four distinct conformational states, including two unique intermediates not observed at neutral pH . These states likely represent different stages in the enzyme's reaction cycle under hypoxic conditions.

How can researchers effectively distinguish between the activities of ATP synthase and ATPase when working with Calycanthus floridus var. glaucus recombinant proteins?

Distinguishing between ATP synthesis and hydrolysis activities requires careful experimental design and specific assay conditions:

For ATP synthase activity measurement:

  • Reconstitute the purified Calycanthus floridus var. glaucus ATP synthase into liposomes with an established proton gradient.

  • Include ADP and inorganic phosphate in the reaction mixture.

  • Monitor ATP formation using luciferase-based assays or coupled enzyme assays.

  • Control experiments should include conditions where the proton gradient is dissipated (using uncouplers like FCCP).

For ATPase activity measurement:

  • Add ATP to the purified enzyme in the absence of a proton gradient.

  • Monitor ATP hydrolysis by:

    • Detecting released inorganic phosphate using colorimetric methods (malachite green assay)

    • Using coupled enzyme assays that link ATP hydrolysis to NADH oxidation

Distinguishing factors:

  • Oligomycin sensitivity can help differentiate between the activities, as it inhibits both ATP synthesis and ATP-driven proton pumping .

  • Different pH and ionic conditions can favor one direction over the other.

  • The relative concentrations of ATP, ADP, and Pi can shift the equilibrium between synthesis and hydrolysis.

What are the current theoretical models explaining the kinetic advantage of the rotary mechanism in ATP synthase, and how can these be experimentally validated?

The rotary mechanism of ATP synthase has evolved as a highly complex yet efficient energy conversion system. Current theoretical models explaining its kinetic advantages include:

1. State-dependent catalysis model:
This model proposes that the rotary mechanism allows for state-dependent catalysis where each of the three catalytic sites in F₁ cycles through different conformational states (loose, tight, and open), optimizing the energetics of ATP synthesis .

2. Mechanochemical coupling model:
This model suggests that the rotary mechanism provides tight coupling between proton translocation and ATP synthesis, minimizing energy loss during energy conversion .

3. Energy storage model:
The rotary mechanism may allow for temporary storage of energy in elastic elements within the protein complex, smoothing out energy input fluctuations.

Experimental validation approaches:

  • Single-molecule rotation assays using fluorescently labeled subunits to directly observe rotational dynamics under varying conditions

  • Comparison of ATP synthesis rates under different proton motive force conditions (pH vs. electrical potential components)

  • Site-directed mutagenesis of key residues involved in the rotary mechanism to test specific aspects of the models

Research has demonstrated that when alternative models (such as alternating-access mechanisms) are optimized under fundamental thermodynamic constraints, they fail to match the kinetic efficiency of the rotary mechanism, particularly under low-energy conditions . This suggests evolutionary selection for the complex rotary mechanism was driven by its superior kinetic properties.

How does ATP synthase kinetic behavior differ when driven by transmembrane pH gradient versus electrical potential difference?

The question of "kinetic equivalence" between pH gradient and electrical potential as driving forces for ATP synthesis has been debated in the scientific literature. Current understanding includes:

Research findings:

  • Some studies report complete kinetic equivalence, where the same ATP synthesis rate is achieved with equivalent proton motive force (PMF) regardless of the relative contributions of ΔpH and Δψ .

  • Other studies suggest non-equivalence, with a minimal transmembrane potential threshold required for enzyme activation .

Explanatory factors for contradictory reports:

  • Experimental conditions: Differences in in vitro conditions beyond substrate concentration contribute to varying reported rates. For example, chloroplast ATP synthase rates vary widely across studies (0-400 ATP per second) .

  • Structural considerations: The arrangement of charged residues in the proton channel may respond differently to pH gradients versus electrical potentials.

  • Subunit-specific effects: Calycanthus floridus var. glaucus ATP synthase subunit a (atpI) contains several charged residues that might interact differently with pH gradients versus electrical fields, potentially affecting kinetics in a species-specific manner .

Methodological approaches for investigation:

  • Design experiments that carefully isolate and control ΔpH and Δψ components

  • Utilize patch-clamp techniques combined with ATP synthesis measurements

  • Employ kinetic modeling to account for experimental variables

A systematic understanding of these kinetic properties is essential for correctly interpreting experimental results and understanding the in vivo behavior of ATP synthase under various physiological conditions.

What experimental approaches are most suitable for studying ATP synthase function under hypoxic conditions?

Recent research has highlighted the importance of understanding ATP synthase function under hypoxic conditions, which are relevant to various diseases including cancer and cardiac ischemia . When studying Calycanthus floridus var. glaucus ATP synthase under hypoxic conditions, consider the following experimental approaches:

1. Controlled oxygen tension systems:

  • Utilize hypoxia chambers that maintain precise oxygen concentrations

  • Implement oxygen-scavenging enzyme systems for solution-based assays

2. pH monitoring and control:

  • Since hypoxia leads to acidification, incorporate real-time pH monitoring

  • Design buffers that maintain stable pH despite metabolic acid production

3. Metabolic flux analysis:

  • Use isotope-labeled substrates (¹³C-glucose, ¹⁵N-amino acids) to track metabolic pathways

  • Combine with mass spectrometry to quantify metabolite levels

4. Conformation and activity correlation:

  • Apply structural techniques (cryo-EM) under hypoxic conditions

  • Simultaneously measure enzyme activity to correlate structure with function

5. Mitochondrial/chloroplast isolation techniques:

  • Develop protocols that maintain organelle integrity during isolation

  • Ensure preservation of membrane potential for accurate measurements

Data analysis considerations:

  • Account for the reversible nature of the enzyme when interpreting results

  • Consider the interplay between glycolysis and oxidative phosphorylation under hypoxia

Research has shown that under acidic conditions (associated with hypoxia), ATP synthase adopts unique conformational states that may represent adaptation mechanisms to function in oxygen-limited environments . Understanding these adaptations could lead to new therapeutic approaches for diseases characterized by tissue hypoxia.

How can structural studies of Calycanthus floridus var. glaucus ATP synthase contribute to drug development efforts?

ATP synthase has emerged as a drug target for various diseases, including infectious diseases, cardiovascular conditions, and cancer . Structural studies of Calycanthus floridus var. glaucus ATP synthase can contribute to drug development in several ways:

1. Comparative structural analysis:
Structural comparison between plant and human/bacterial ATP synthases can reveal species-specific features that enable selective targeting. For example, bedaquiline (Sirturo) is an FDA-approved drug that selectively targets mycobacterial ATP synthase for tuberculosis treatment .

2. Identification of conformational states:
Recent studies have identified novel conformational states under acidic conditions . Understanding these states in Calycanthus floridus var. glaucus ATP synthase may reveal:

  • Unique binding pockets that appear only in certain conformational states

  • Allosteric sites that could be targeted to modulate enzyme activity

  • Species-specific interfaces between subunits

3. Methodological approach for drug development:

  • Obtain high-resolution structures of Calycanthus floridus var. glaucus ATP synthase in different conformational states

  • Perform in silico screening against identified binding pockets

  • Validate potential binding sites through site-directed mutagenesis

  • Develop plant-specific inhibitors as research tools or potential agricultural compounds

The unique amino acid sequence of Calycanthus floridus var. glaucus ATP synthase subunit a contains regions that differ from those in human and bacterial homologs, providing opportunities for selective targeting .

What are the technical challenges in expressing and purifying functional Recombinant Calycanthus floridus var. glaucus ATP synthase for structural studies?

Expression and purification of membrane proteins like ATP synthase present numerous technical challenges that must be addressed for successful structural studies:

Expression challenges:

  • Host selection: Standard bacterial expression systems often fail to correctly fold plant membrane proteins. Consider using plant-based expression systems or specialized bacterial strains.

  • Membrane protein toxicity: Overexpression of membrane proteins can be toxic to host cells. Inducible expression systems with tight regulation are recommended.

  • Post-translational modifications: Plant proteins may require specific modifications not present in heterologous systems.

Purification challenges and solutions:

  • Detergent selection: Membrane proteins require detergents for solubilization, but these can destabilize the native structure.

    • Systematic screening of detergents is essential

    • Consider using amphipols or nanodiscs for improved stability

  • Maintaining complex integrity: ATP synthase is a multi-subunit complex that can dissociate during purification.

    • Mild solubilization conditions are crucial

    • Consider crosslinking approaches or co-expression strategies

  • Functional assessment: Verification of activity is essential, as structural studies require functional protein.

    • Develop activity assays compatible with detergent-solubilized protein

    • Monitor both ATP synthesis and hydrolysis activities

Recent technological advances:

  • Styrene-maleic acid copolymer lipid particles (SMALPs) allow extraction of membrane proteins with their native lipid environment

  • Cryo-EM has reduced the requirement for large protein quantities and perfect crystallization

When working with Recombinant Calycanthus floridus var. glaucus ATP synthase subunit a, it is recommended to use the full-length protein (amino acids 1-247) with appropriate storage in Tris-based buffer with 50% glycerol at -20°C or -80°C for long-term storage .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.