Recombinant Calycanthus floridus var. glaucus ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
atpF
Target Protein Sequence
MKNVTDSFVSLGHWPFAGSFGFNTDILATNLINLSVVLGVLIFFGKGVLSDLLDNRKQRI WSTIRNSDELREVAIEQLEKARARLRKVEREADEFRVNGYSEIEREKWNLINATYENLER LENYKNETIHFEQQRAINQVRQRVFQQALQGALGTLNSRSNSELHLRTISANIGMLGAMK EITD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembranous catalytic core, and the F(0) domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Calycanthus floridus var. glaucus and why is its ATP synthase subunit b significant for research?

Calycanthus floridus var. glaucus, commonly known as Carolina Allspice or Eastern sweetshrub (Calycanthus fertilis var. ferax), is a deciduous shrub native to the eastern United States, ranging from Pennsylvania to Florida . This plant belongs to the Calycanthaceae family, which is a small endemic group significant for its unusual winter-blooming characteristics and evolutionary position within the Magnoliids clade .

The ATP synthase subunit b, chloroplastic (atpF) is a crucial component of the chloroplast ATP synthase complex, playing an essential role in photosynthetic energy production. This protein is encoded by the atpF gene in the chloroplast genome and serves multiple research purposes:

  • As a molecular marker in phylogenetic studies to reconstruct evolutionary relationships within Calycanthaceae

  • For understanding bioenergetic processes in plant chloroplasts

  • As a model for studying chloroplast genome evolution and adaptation

  • For comparative genomic analyses across plant species

Chloroplast genetic engineering, including work with genes like atpF, represents an exciting field for developing valuable traits in trees and other plants . The atpF gene has helped resolve phylogenetic relationships within the Calycanthaceae family, particularly between Calycanthus floridus and other species .

How is the atpF gene organized within the chloroplast genome of Calycanthus floridus?

The atpF gene is located within the chloroplast genome of Calycanthus floridus, which has a total size of approximately 153,337 bp . The chloroplast genomes of Calycanthaceae family members (including Calycanthus floridus) share several distinctive characteristics:

  • High similarity in gene content and order across species

  • Consistent GC content (approximately 35%)

  • Similar patterns of codon usage and amino acid frequency

  • Characteristic distribution of simple sequence repeats and oligonucleotide repeats

  • Conserved patterns of synonymous and non-synonymous substitutions

The complete chloroplast genome of Calycanthus floridus contains 121 genes, including protein-coding genes like atpF, rRNA genes, and tRNA genes . Unlike some other plant families, the Calycanthaceae chloroplast genomes maintain relatively stable gene arrangements, which has contributed to their value in evolutionary studies.

Similar to other chloroplast genes, atpF is transcribed by a chloroplast-specific RNA polymerase and plays a critical role in the ATP synthase complex, which is essential for photophosphorylation during photosynthesis.

How do atpF gene sequences compare across species in the Calycanthaceae family?

Comparative analysis of atpF sequences across Calycanthaceae species provides valuable insights into evolutionary relationships and molecular evolution. The table below summarizes key comparative findings:

SpeciesChloroplast Genome Size (bp)atpF CharacteristicsPhylogenetic Position
Calycanthus floridus153,337Standard selection pressureSister to C. chinensis
Calycanthus chinensis~153,000Standard selection pressureSister to C. floridus
Chimonanthus praecox~153,000Standard selection pressureForms clade with C. campanulatus
Chimonanthus campanulatus~153,000Shows signs of positive selectionForms clade with C. praecox
Chimonanthus grammatus~153,000Standard selection pressureDiverged from other Chimonanthus species in late Miocene
Chimonanthus nitens~153,000Standard selection pressureAppears paraphyletic
Chimonanthus salicifolius~153,000Standard selection pressureClose relationship with C. nitens
Chimonanthus zhejiangensis~153,000Standard selection pressureClose relationship with C. nitens

Phylogenetic analyses using atpF and other chloroplast genes have established that:

  • Calycanthus and Chimonanthus are monophyletic genera

  • Within Chimonanthus, C. praecox and C. campanulatus form one clade, while C. grammatus, C. salicifolius, C. zhejiangensis, and C. nitens constitute another clade

  • Calycanthus floridus and Calycanthus chinensis show distinctive morphological features including brownish trichomes, while Chimonanthus species share transparent trichomes on leaf midveins

These molecular comparisons have helped resolve taxonomic relationships and suggest that some species, particularly C. nitens, may need taxonomic reevaluation due to paraphyletic positioning in the phylogenetic tree .

What experimental approaches are most effective for studying the function of recombinant Calycanthus floridus atpF protein?

Investigating the function of recombinant Calycanthus floridus var. glaucus ATP synthase subunit b requires an integrated experimental approach combining molecular biology, biochemistry, and biophysical techniques:

Protein Production and Purification

  • Expression Systems

    • E. coli expression: The most common system, using BL21(DE3) or Rosetta strains with pET vectors containing codon-optimized atpF gene

    • Alternative systems: Insect cells (baculovirus) or yeast expression for enhanced post-translational modifications

  • Purification Strategy

    • Initial capture: IMAC purification using His-tag chromatography (Ni-NTA resin)

    • Secondary purification: Size exclusion chromatography to remove aggregates

    • Purity assessment: SDS-PAGE analysis (target >85% purity)

Functional Characterization

  • Biophysical Analysis

    • Circular dichroism: To analyze secondary structure content

    • Thermal shift assays: To evaluate protein stability

    • Light scattering: To determine oligomeric state

  • Integration into ATP Synthase Complex

    • Reconstitution assays: Combining recombinant atpF with other ATP synthase subunits

    • Liposome incorporation: Embedding the protein in artificial membrane systems

    • Proton translocation assays: Using pH-sensitive dyes to monitor function

  • Mutagenesis Studies

    • Alanine scanning: Systematically replacing residues to identify functional positions

    • Domain swapping: Exchanging regions with homologs from other species

    • Deletion analysis: Removing specific domains to assess their contribution

Advanced Structural Studies

  • Crystallographic Approaches

    • Crystallization trials: Screening conditions for protein crystal formation

    • X-ray diffraction: Determining atomic-level structure

    • Molecular replacement: Using homologous structures as templates

  • Alternative Structural Methods

    • Cryo-electron microscopy: For visualization of the protein in its native complex

    • NMR spectroscopy: For dynamic structural information

    • Cross-linking mass spectrometry: To map protein-protein interactions

This multilayered approach allows for comprehensive functional characterization, from basic biochemical properties to detailed mechanistic insights into how the atpF protein contributes to ATP synthase function.

What are the optimal conditions for expression and purification of recombinant Calycanthus floridus atpF protein?

Successful expression and purification of functional recombinant Calycanthus floridus var. glaucus ATP synthase subunit b requires careful optimization of multiple parameters. Based on available data for atpF and related proteins , the following protocol provides comprehensive guidelines:

Expression Optimization

ParameterRecommended ConditionsNotes
Expression vectorpET series (T7 promoter)pET28a(+) with N-terminal His-tag shows good results
E. coli strainBL21(DE3) or Rosetta(DE3)Rosetta strain addresses rare codon usage issues
Growth mediumLB or TB supplemented with glucose (0.2%)TB medium can increase yield by 2-3 fold
Induction OD₆₀₀0.6-0.8Mid-log phase provides optimal balance
IPTG concentration0.2-0.5 mMLower concentrations reduce inclusion body formation
Induction temperature16-18°CLower temperature promotes proper folding
Induction duration16-20 hoursExtended incubation at lower temperature

Purification Protocol

  • Cell Lysis

    • Resuspend cells in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF)

    • Lyse by sonication or high-pressure homogenization

    • Centrifuge at 12,000 × g for 30 minutes to remove debris

  • Affinity Purification

    • Apply supernatant to Ni-NTA resin equilibrated with binding buffer

    • Wash with 20-50 mM imidazole to remove non-specific binding

    • Elute with 250-300 mM imidazole gradient

  • Secondary Purification

    • Perform size exclusion chromatography using Superdex 200 column

    • Mobile phase: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

  • Storage Conditions

    • Add glycerol to 50% final concentration

    • Aliquot in small volumes (50-100 μL)

    • Flash freeze in liquid nitrogen

    • Store at -80°C for long-term or -20°C for medium-term storage

    • Working aliquots can be kept at 4°C for up to one week

  • Quality Control

    • SDS-PAGE analysis: target >85% purity

    • Western blot confirmation with anti-His antibodies

    • Mass spectrometry to verify protein identity

    • Circular dichroism to confirm proper folding

Troubleshooting Common Issues

  • Poor Solubility

    • Add mild detergents (0.1% Triton X-100 or 0.5% CHAPS) to extraction buffer

    • Co-express with molecular chaperones (GroEL/GroES)

    • Use fusion partners (MBP, SUMO, TrxA) to enhance solubility

  • Low Yield

    • Optimize codon usage for E. coli

    • Screen multiple expression strains and conditions

    • Consider autoinduction media for higher cell density

  • Protein Instability

    • Add stabilizing agents (5-10 mM β-mercaptoethanol, 1 mM DTT)

    • Test different pH values (7.0-8.5) and buffer systems

    • Include protease inhibitor cocktail throughout purification

Following these optimized conditions should yield pure, functional recombinant atpF protein suitable for biochemical and structural studies .

What evolutionary insights have been gained from studying atpF sequences across Calycanthaceae species?

Analysis of atpF sequences across Calycanthaceae species has provided significant evolutionary insights at multiple levels. Comprehensive chloroplast genome studies have revealed:

Divergence Time Estimates

Evolutionary EventEstimated Time (Ma)95% HPD Interval (Ma)Geological Period
Chimonanthus-Calycanthus divergence29.8817.19-45.50Mid-Oligocene
Calycanthus chinensis-C. floridus split17.279.31-29.50Early Miocene
C. praecox/C. campanulatus clade divergence15.208.82-24.96Mid-Miocene
C. praecox-C. campanulatus split11.896.04-19.80Late Miocene
C. grammatus divergence7.013.89-11.74Late Miocene

These divergence times correlate with major geological and climatic events, suggesting environmental influences on speciation within Calycanthaceae .

Selection Pressure Analysis

Examination of selection pressures on atpF has revealed patterns of molecular evolution:

  • Purifying selection: Most Calycanthaceae species show evidence of purifying selection on atpF, with Ka/Ks ratios significantly below 1.0, indicating functional constraints on the protein.

  • Positive selection: In Chimonanthus campanulatus, atpF shows signatures of positive selection, suggesting adaptive evolution potentially conferring selective advantages in specific environmental conditions .

  • Mutation correlations: The study found interesting correlations between different types of mutations:

    • Strong correlations between substitutions and InDels at the family level (average r = 0.43)

    • Moderate to strong correlations between InDels and repeats (average r = 0.39)

    • Weak correlations between substitutions and repeats (average r = 0.195)

    • Notably weaker correlations among closely related species compared to distantly related taxa

Phylogenetic Implications

  • Generic relationships: atpF sequences firmly support the monophyly of both Calycanthus and Chimonanthus genera.

  • Species relationships: Within Chimonanthus, two major clades are supported:

    • C. praecox + C. campanulatus

    • C. grammatus + (C. salicifolius + C. zhejiangensis + C. nitens)

  • Taxonomic reassessment needs: Molecular evidence suggests Chimonanthus nitens may be paraphyletic and closely related to C. salicifolius and C. zhejiangensis, indicating potential need for taxonomic reevaluation .

  • Morphological correlations: Molecular phylogeny based on atpF and other chloroplast genes correlates with certain morphological traits, such as trichome characteristics, providing insight into character evolution .

These findings demonstrate how atpF sequence analysis contributes to understanding plant evolution at multiple taxonomic levels, from deep-time divergences to recent speciation events.

How do mutations in the atpF gene affect ATP synthase function in chloroplasts?

Mutations in the atpF gene can significantly impact chloroplast ATP synthase function through various mechanisms. While specific experimental data on Calycanthus floridus atpF mutations are not directly available in the search results, we can draw insights from related research on ATP synthase structure-function relationships:

Functional Impacts of atpF Mutations

Mutation TypeRegion AffectedFunctional ImpactPhysiological Consequence
Transmembrane domain mutationsN-terminal hydrophobic regionDisrupted membrane anchoringCompromised proton translocation
Stalk domain mutationsMiddle regionDestabilized F₀-F₁ connectionReduced coupling efficiency
Interface mutationsResidues at subunit interfacesImpaired complex assemblyDecreased ATP synthase levels
Charged residue substitutionsRegions involved in ionic interactionsAltered electrostatic propertiesModified proton handling
Positive selection sitesC. campanulatus-specific sitesPotential adaptive advantagesEnhanced fitness in specific conditions

Evidence from Evolutionary Studies

The discovery of positive selection in the atpF gene of Chimonanthus campanulatus provides indirect evidence for the functional significance of specific amino acid changes. This positive selection (Ka/Ks > 1) suggests that certain mutations confer selective advantages, potentially by optimizing ATP synthase function under particular environmental conditions.

The comparative analysis of atpF sequences across Calycanthaceae species has revealed both highly conserved regions (under strong purifying selection) and variable regions that may accommodate adaptive changes . The conserved regions likely represent functionally critical domains where mutations would be severely deleterious.

Experimental Approaches to Study atpF Mutations

  • Site-directed mutagenesis

    • Target conserved residues identified through sequence alignment

    • Create recombinant proteins with specific mutations

    • Assess effects on protein stability, complex assembly, and enzyme activity

  • Structural analysis

    • Use homology modeling based on related ATP synthase structures

    • Identify critical interaction interfaces

    • Predict effects of mutations on protein folding and interactions

  • Functional reconstitution

    • Incorporate wild-type and mutant atpF proteins into liposomes

    • Measure ATP synthesis rates and proton translocation efficiency

    • Quantify effects on coupling ratio (ATP produced per proton translocated)

  • In vivo studies

    • Transform chloroplast genome with mutated atpF genes

    • Assess photosynthetic parameters in resulting transplastomic plants

    • Measure growth and fitness under different environmental conditions

Understanding the effects of atpF mutations provides fundamental insights into chloroplast bioenergetics and may inform strategies for engineering more efficient photosynthetic machinery in crop plants.

What structural features of ATP synthase subunit b are critical for chloroplastic ATP synthesis?

ATP synthase subunit b (atpF) contains several key structural features that are essential for its function in chloroplastic ATP synthesis. Analysis of the Calycanthus floridus var. glaucus atpF sequence and comparison with related proteins reveals these critical structural elements:

Key Structural Domains and Their Functions

DomainAmino Acid PositionStructural FeaturesFunctional Role
Transmembrane domain~1-40Single α-helical membrane spanAnchors protein in thylakoid membrane
Membrane-proximal region~41-70Amphipathic α-helixTransition from membrane to aqueous phase
Dimerization interfaceThroughout stalkCoiled-coil motifsForms b₂ dimer for structural stability
Stalk region~71-140Extended α-helixMaintains proper F₀-F₁ distance
F₁-interaction domain~141-184C-terminal regionBinds to δ and α subunits of F₁ sector

Structural Mechanism in ATP Synthesis

The ATP synthase functions as a rotary molecular motor, with subunit b serving as a critical component of the stator complex:

  • Mechanical stability: The rigid structure of subunit b provides a stable connection between the membrane-embedded F₀ and the catalytic F₁ sectors.

  • Torque resistance: During ATP synthesis, the rotating components (c-ring, γ, ε subunits) generate torque that must be counteracted by the stator, which includes subunit b.

  • Conformational transmission: The extended structure of subunit b allows for efficient transmission of conformational changes between F₀ and F₁ sectors.

  • Delta subunit interaction: The C-terminal region of subunit b interacts with the δ subunit of F₁, forming part of the connection between the stator and catalytic components.

The positive selection observed in Chimonanthus campanulatus atpF suggests that specific structural modifications may provide adaptive advantages in certain environmental conditions, potentially by optimizing the efficiency of ATP synthesis or enhancing structural stability.

How can researchers effectively utilize atpF as a phylogenetic marker in plant evolutionary studies?

The atpF gene has proven to be a valuable phylogenetic marker for plant evolutionary studies, particularly within the Calycanthaceae family. Based on research methodologies described in the search results , the following comprehensive approach can be implemented:

Sampling and Sequencing Strategy

  • Taxonomic sampling

    • Include representatives from all genera and species of interest

    • Sample multiple individuals per species when possible to capture intraspecific variation

    • Include appropriate outgroups for phylogenetic rooting

  • DNA extraction and quality control

    • Use specialized plant DNA extraction protocols to handle secondary metabolites

    • Assess DNA quality using spectrophotometry and gel electrophoresis

    • Quantify DNA accurately for downstream applications

  • Sequencing approaches

    • Targeted sequencing: Design specific primers to amplify the atpF gene

    • Chloroplast genome sequencing: Obtain the entire plastome including atpF

    • Next-generation sequencing: Use Illumina or PacBio platforms for high-throughput data generation

Analytical Methods

  • Sequence processing and alignment

    • Clean and trim raw sequence data

    • Perform multiple sequence alignment using MAFFT

    • Remove indels if focusing solely on substitution mutations

    • Assess alignment quality and adjust manually if necessary

  • Evolutionary model selection

    • Use JModelTest2 to determine the best-fit evolutionary model

    • Consider partition models for different functional regions of the gene

    • Evaluate parameter-rich vs. simplified models based on sample size

  • Phylogenetic inference methods

    • Maximum likelihood: Implement using IQ-tree with bootstrap replicates (100 or more)

    • Bayesian inference: Use BEAST for phylogeny and divergence time estimation

    • Parsimony and distance methods: For comparative analysis

  • Molecular dating

    • Calibrate trees using fossil records (e.g., Araripia florifera, Jereysanthus calycanthoides)

    • Implement relaxed clock models to account for rate variation

    • Assess confidence with 95% higher posterior densities (HPD)

Advanced Analytical Approaches

  • Selection pressure analysis

    • Calculate synonymous (Ks) and non-synonymous (Ka) substitution rates

    • Identify patterns of purifying or positive selection (Ka/Ks ratio)

    • Compare selection patterns across lineages

  • Mutation pattern analysis

    • Analyze correlations between different types of mutations:

      • Substitutions and InDels (found to have strong correlation at family level, avg r=0.43)

      • InDels and repeats (moderate to strong correlation, avg r=0.39)

      • Substitutions and repeats (typically weaker correlation, avg r=0.195)

  • Comparative phylogenetics

    • Combine atpF with other chloroplast markers for multigene analyses

    • Test for congruence between chloroplast and nuclear markers

    • Integrate molecular phylogenies with morphological, ecological, or biogeographical data

Application Example: Calycanthaceae Phylogeny

The study of Calycanthaceae demonstrates an effective application of atpF in phylogenetic analysis:

  • Key findings:

    • Confirmed monophyly of Calycanthus and Chimonanthus genera

    • Resolved species relationships within Chimonanthus into two major clades

    • Identified potential paraphyly in Chimonanthus nitens

    • Estimated divergence times for major evolutionary events

  • Methodological strength:

    • Combined atpF with whole chloroplast genome data

    • Applied both maximum likelihood and Bayesian methods

    • Calibrated divergence times using fossil evidence

    • Integrated molecular findings with morphological traits (trichome characteristics)

By following these comprehensive methodological approaches, researchers can effectively utilize atpF as a powerful marker for addressing diverse questions in plant evolutionary biology, from deep phylogenetic relationships to recent speciation events.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.