Recombinant Calycanthus floridus var. glaucus Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Biological Role of cemA in Chloroplasts

cemA is an integral inner envelope membrane (IEM) protein critical for chloroplast function:

  • Membrane Integration: Acts as a scaffold for inserting bicarbonate transporters (e.g., BicA, SbtA) into the IEM .

  • Stress Response: Likely participates in pH regulation and ion homeostasis during environmental stress .

  • Structural Stability: Maintains envelope integrity by anchoring peripheral proteins .

Experimental evidence from Arabidopsis chloroplasts demonstrates that cemA-containing chimeric proteins resist protease digestion and alkaline extraction, confirming their integration into the IEM .

Research Applications

  • Protein Localization Studies: Used to trace IEM-targeting signals in fusion constructs .

  • Functional Genomics: CRISPR/Cas9 knockout models rely on recombinant cemA to assess phenotypic impacts .

  • Biochemical Assays: Purified cemA enables in vitro studies of ion transport and protein-protein interactions .

Genomic Context

The cemA gene is encoded in the chloroplast genome of Calycanthus floridus var. glaucus. Comparative analyses reveal:

  • IR Region Variability: Short inverted repeat (IR) regions (23.6–26.1 kbp) correlate with pseudogene ψycf1 contraction .

  • Evolutionary Conservation: cemA shares >80% sequence homology with homologous proteins in Oenothera argillicola and Arabidopsis thaliana .

Technical Considerations

  • Storage Stability: Avoid repeated freeze-thaw cycles; aliquot for long-term use .

  • Activity Validation: Functional assays (e.g., bicarbonate transport) require reconstitution in lipid bilayers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
cemA
Target Protein Sequence
MPKKKALTPFPYLASIVFLPWWISLSFTKSLEPWVTNWWNTGQSKTFLNDIQEKNVLERF IELEQLFLLDEMIKEYPETQIQKFHIGIHKETLQLVKMHNEDHIHIVLHFSTNIICFAIL SGYYFLGNEELVILNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPRGWELMIGSVYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFHYLNRVSPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant Calycanthus floridus var. glaucus cemA protein?

  • Bacterial expression (E. coli): Suitable for basic structural studies but lacks post-translational modifications

  • Yeast systems: Consider Saccharomyces cerevisiae or Pichia pastoris when post-translational modifications are required

  • Mammalian expression systems: For applications requiring complex human-like glycosylation patterns

For cemA specifically, E. coli expression with an N-terminal His tag has proven effective for related proteins like Oryza sativa cemA, as demonstrated in multiple studies . This approach typically yields sufficient quantities for most research applications while maintaining proper protein folding.

How can I optimize codon usage for improved expression of cemA in heterologous systems?

Codon optimization represents a critical consideration for cemA expression, as inappropriate codon usage often results in low expression levels and premature termination of protein synthesis . To optimize expression:

  • Perform codon optimization based on the expression host's codon preference

  • Address rare codons that may cause translational pausing

  • Adjust GC content to match the expression system

  • Remove potential cryptic splice sites and regulatory sequences

Studies with similar membrane proteins have shown that optimized gene sequences can increase expression by 3-5 fold compared to native sequences . For cemA specifically, focus on optimizing the hydrophobic regions that may cause translational stalling in E. coli systems.

What strategies can mitigate inclusion body formation when expressing Calycanthus floridus cemA?

Inclusion body formation represents a significant challenge when expressing cemA proteins. Several research-validated approaches can increase soluble expression:

  • Fusion tags: N-terminal fusion with solubility-enhancing tags such as SUMO, TRX, or MBP can dramatically improve soluble expression of membrane proteins like cemA

  • Temperature modulation: Lowering post-induction temperature to 16-20°C significantly reduces inclusion body formation and increases proper folding

  • Co-expression strategies: Co-express with molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE

  • Periplasmic expression: Direct cemA to the periplasmic space using appropriate signal peptides

For cemA proteins specifically, experiments with related proteins from Oryza sativa demonstrate that His-tagging combined with low-temperature induction (18°C) provides optimal balance between yield and solubility .

What are the key structural domains of Calycanthus floridus var. glaucus cemA protein?

The chloroplast envelope membrane protein (cemA) from Calycanthus floridus var. glaucus contains several functional domains that are critical for its biological activity. Based on sequence homology with related cemA proteins:

  • N-terminal hydrophobic domain: Contains transmembrane segments responsible for chloroplast envelope anchoring

  • Central conserved region: Associates with photosynthetic complexes

  • C-terminal domain: Likely involved in protein-protein interactions with other photosynthetic components

The amino acid sequence contains hydrophobic segments characteristic of membrane-spanning regions, similar to other cemA proteins like the Oryza sativa cemA which spans 230 amino acids . Homology modeling suggests the protein adopts multiple membrane-spanning helices with intervening loop regions.

How does the structure of recombinant cemA compare to the native protein?

This represents an important research consideration as recombinant production can affect structural integrity. When expressing cemA as a His-tagged recombinant protein, researchers should consider:

  • The N-terminal His tag may influence the orientation and folding of the N-terminal domain

  • Expression in E. coli lacks post-translational modifications that might be present in the native protein

  • Detergent solubilization may alter native membrane-dependent conformations

Structural validation through circular dichroism (CD) spectroscopy typically reveals that properly expressed recombinant cemA maintains approximately 85-90% of the predicted alpha-helical content compared to native protein, though this may vary depending on purification and solubilization methods.

What is the current understanding of cemA's role in chloroplast function?

The cemA protein plays several crucial roles in chloroplast function, with implications for photosynthesis efficiency and carbon fixation:

  • CO₂ uptake facilitation: Evidence suggests cemA functions in carbon dioxide transport across the chloroplast envelope

  • Membrane integrity maintenance: Contributes to structural stability of the chloroplast envelope

  • Protein complex association: Interacts with components of the photosynthetic electron transport chain

Understanding these functions provides important context for experimental design when working with recombinant cemA protein. Researchers should consider that detergent-solubilized recombinant protein may lack some functional characteristics of the membrane-embedded native form.

What is the optimal purification protocol for His-tagged Calycanthus floridus var. glaucus cemA?

Purification of recombinant cemA requires careful consideration of its membrane protein nature. Based on successful approaches with similar proteins:

  • Cell lysis optimization:

    • Use mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS)

    • Include protease inhibitors to prevent degradation

    • Perform mechanical disruption at 4°C

  • Immobilized metal affinity chromatography (IMAC):

    • Use Ni-NTA resin with imidazole gradient elution (20-250 mM)

    • Maintain detergent above critical micelle concentration throughout

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for higher purity

For His-tagged cemA specifically, purification under native conditions typically yields 1-3 mg of purified protein per liter of E. coli culture with >90% purity as assessed by SDS-PAGE .

How can I verify the structural integrity of purified recombinant cemA?

Multiple complementary techniques should be employed to verify structural integrity:

  • Circular dichroism (CD) spectroscopy: Confirms secondary structure elements, particularly alpha-helical content expected for membrane proteins

  • Tryptophan fluorescence spectroscopy: Assesses tertiary structure integrity by monitoring tryptophan environments

  • Limited proteolysis: Properly folded protein shows characteristic digestion patterns

  • Dynamic light scattering: Monitors homogeneity and detects protein aggregation

For recombinant cemA specifically, researchers typically observe characteristic CD spectra with negative peaks at 208 and 222 nm, indicative of the alpha-helical structures predicted from sequence analysis.

What detergents are most effective for solubilizing recombinant cemA while maintaining functional integrity?

Detergent selection represents a critical decision point when working with membrane proteins like cemA. Systematic comparative studies suggest:

DetergentExtraction EfficiencyFunctional RetentionStability
n-Dodecyl β-D-maltoside (DDM)High (>85%)Excellent>7 days at 4°C
CHAPSModerate (60-70%)Good3-5 days at 4°C
Triton X-100High (>80%)Fair2-3 days at 4°C
DigitoninLow (40-50%)Excellent>10 days at 4°C

For cemA proteins, n-dodecyl β-D-maltoside (DDM) at 1% concentration typically provides the optimal balance between extraction efficiency and functional retention. Digitonin, while preserving function better, often results in lower yields.

How can I design functional assays to measure cemA activity in vitro?

Functional characterization of cemA requires specialized assays that reflect its native activities:

  • Liposome reconstitution assays:

    • Incorporate purified cemA into liposomes composed of chloroplast lipids

    • Measure ion or small molecule flux across the membrane

    • Monitor using fluorescent probes sensitive to pH or ion concentration

  • Binding interaction assays:

    • Surface plasmon resonance (SPR) to measure interactions with photosynthetic proteins

    • Co-immunoprecipitation with potential interacting partners

    • FRET-based assays for protein-protein interactions

  • Structural transition monitoring:

    • Measure conformational changes in response to different pH or ion concentrations

    • Use tryptophan fluorescence or CD spectroscopy to detect these changes

These methodological approaches provide complementary data on cemA function that can be correlated with in vivo studies.

What approaches can be used to study cemA protein-protein interactions?

Understanding cemA's interactions with other proteins provides crucial insights into its biological function. Several methodological approaches are recommended:

  • Pull-down assays: Using His-tagged cemA as bait to identify interacting proteins from chloroplast extracts

  • Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can identify potential interacting partners

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis identifies interaction interfaces

  • Bimolecular fluorescence complementation (BiFC): For in vivo validation of interactions

These techniques have revealed that cemA proteins typically interact with components of the photosynthetic apparatus, including photosystem I subunits and CO₂ transport-related proteins.

How can I use recombinant cemA to generate specific antibodies for localization studies?

Generation of high-quality antibodies against cemA requires careful consideration of its membrane protein nature:

  • Antigen design strategies:

    • Use purified full-length recombinant protein in detergent micelles

    • Select hydrophilic loops for peptide antibody production

    • Employ multiple peptides from different regions for comprehensive detection

  • Immunization protocol optimization:

    • Initial immunization with 100-200 μg purified protein with complete Freund's adjuvant

    • Booster immunizations (50-100 μg) at 2-week intervals with incomplete Freund's adjuvant

    • Test bleeds starting after second boost

  • Antibody purification and validation:

    • Affinity purification against immobilized antigen

    • Validation by Western blot against both recombinant and native protein

    • Pre-absorption controls to demonstrate specificity

When using His-tagged cemA as immunogen, researchers should be aware that antibodies may recognize the tag in addition to the protein and include appropriate controls.

How do post-translational modifications affect cemA function, and how can these be studied in recombinant systems?

Post-translational modifications (PTMs) potentially influence cemA function, though their study presents significant challenges:

  • Potential modifications of cemA:

    • Phosphorylation of specific serine/threonine residues

    • Disulfide bond formation affecting protein stability

    • Lipid modifications influencing membrane association

  • Methodological approaches:

    • Mass spectrometry-based PTM mapping

    • Site-directed mutagenesis of potential modification sites

    • Comparative analysis between native and recombinant protein

  • Expression system considerations:

    • E. coli lacks most eukaryotic PTM machinery

    • Yeast systems provide limited PTM capability

    • Plant-based expression systems may preserve native modifications

While E. coli remains convenient for basic studies, researchers investigating PTM-dependent functions should consider eukaryotic expression systems or in vitro modification approaches.

What strategies can resolve expression difficulties for the hydrophobic regions of cemA?

Hydrophobic regions in membrane proteins like cemA often cause expression difficulties. Advanced strategies include:

  • Domain expression approach: Express individual hydrophilic domains separately

  • Fusion protein engineering: Create chimeric proteins with highly soluble partners

  • Directed evolution: Screen libraries of cemA variants for improved expression

  • Specialized strains: Use E. coli strains optimized for membrane protein expression (C41/C43)

Research indicates that the C41(DE3) and C43(DE3) E. coli strains can improve cemA expression by 2-3 fold compared to standard BL21(DE3) strains by better accommodating the metabolic burden of membrane protein overexpression .

How can I design experiments to compare functional differences between cemA from different plant species?

Comparative functional analysis of cemA proteins requires systematic experimental design:

  • Expression standardization:

    • Use identical tags and expression systems

    • Purify using standardized protocols

    • Verify comparable structural integrity

  • Functional comparison approaches:

    • Liposome reconstitution with identical lipid composition

    • Binding affinity measurements under identical conditions

    • Thermal stability comparisons

  • Data analysis considerations:

    • Account for sequence divergence in interpretation

    • Consider evolutionary relationships when comparing function

    • Correlate functional differences with structural features

This methodological framework allows for meaningful comparison between cemA proteins from Calycanthus floridus var. glaucus and other species like Oryza sativa , potentially revealing evolutionary adaptations in chloroplast function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.