Recombinant Calycanthus floridus var. glaucus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Product Overview and Biochemical Properties

The petD subunit (UniProt IDs: Q7YJU7 , Q84TU6 ) is a chloroplast-encoded protein with a molecular weight corresponding to its full-length or partial sequence. Key properties include:

PropertyDetailsSource
Expression SystemE. coli
Purity>85% (SDS-PAGE)
TagHis-tag (N-terminal)
Protein LengthFull-length (1–167 aa) or partial sequence
Storage BufferTris-based buffer with 50% glycerol
Shelf Life12 months (lyophilized) or 6 months (liquid) at -20°C/-80°C

Applications and Research Context

The petD protein is utilized in:

  • Structural and Functional Studies: Investigating electron transport mechanisms in photosynthesis.

  • Immunoassays: ELISA kits (e.g., CSB-EP765937CBM ) for detecting petD antibodies.

  • Protein Interaction Studies: Examining subunit assembly in the cytochrome b6-f complex.

Suppliers and Availability

Recombinant petD is commercially available from multiple vendors:

SupplierProduct CodeKey FeaturesPriceSource
CUSABIO TECHNOLOGY LLCCSB-EP915629204Partial sequence, >85% purityNot listed
Creative BiomartRFL19259EFFull-length, His-taggedNot listed
AnagnosticsCSB-EP765937CBM (ELISA)50 µg vial for immunoassays$1,511.00

Research Findings and Challenges

  • Structural Insights: The full-length His-tagged version (RFL19259EF ) facilitates crystallization studies.

  • Discrepancies in UniProt IDs: Conflicting entries (Q7YJU7 vs. Q84TU6) highlight potential isoform variations or database inconsistencies.

  • Functional Studies: Limited data on enzymatic activity or redox potential, underscoring the need for further research.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYISPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVLVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLFQVDLTVK
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6-f complex subunit 4 (petD) and what is its role in photosynthesis?

The petD gene encodes the Cytochrome b6-f complex subunit 4, a critical component of the photosynthetic electron transport chain in chloroplasts of Calycanthus floridus var. glaucus (Eastern sweetshrub). This protein, also known as the 17 kDa polypeptide, is integral to thylakoid membranes and facilitates electron transfer between photosystem II and photosystem I. The protein contributes to proton translocation across the membrane, generating the proton gradient necessary for ATP synthesis during photosynthesis.

The petD protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, where it works in concert with other subunits of the Cytochrome b6-f complex to catalyze the transfer of electrons from plastoquinol to plastocyanin. This process is coupled to proton translocation, making the Cytochrome b6-f complex a key contributor to the chemiosmotic potential used for ATP synthesis.

What is the structure of the Recombinant Calycanthus floridus var. glaucus Cytochrome b6-f complex subunit 4?

The structure of Cytochrome b6-f complex subunit 4 from Calycanthus floridus var. glaucus has been computationally modeled with high confidence, achieving a global pLDDT score of 92.58 according to AlphaFold database (entry AF-Q7YJU7-F1) . The protein consists of 167 amino acid residues and adopts a predominantly α-helical structure with multiple membrane-spanning domains.

The computed structure model reveals the typical features expected of a membrane-embedded protein component of the electron transport chain. The model was released in AlphaFold DB on 2021-12-09 and last modified on 2022-09-30, providing researchers with valuable structural information even in the absence of experimentally determined structures .

The protein's structure is specialized for its role in the thylakoid membrane, with hydrophobic domains that interact with the lipid bilayer and hydrophilic regions that facilitate interactions with other components of the photosynthetic apparatus.

How is the recombinant protein expressed and purified for research applications?

While specific expression protocols for Calycanthus floridus var. glaucus petD are not explicitly detailed in the search results, related cytochrome b6-f complex subunit 4 proteins from other species are typically expressed using E. coli expression systems with N-terminal His-tags to facilitate purification . The general methodology involves:

  • Gene synthesis or cloning of the petD sequence into an appropriate prokaryotic expression vector

  • Transformation of competent E. coli cells with the recombinant plasmid

  • Expression induction under optimized conditions (temperature, inducer concentration, duration)

  • Cell harvest and lysis to extract the recombinant protein

  • Affinity chromatography using Ni-NTA or similar matrices to capture the His-tagged protein

  • Quality assessment using SDS-PAGE to ensure >90% purity

  • Lyophilization or stabilization in appropriate buffer conditions

The purified protein is typically provided as a lyophilized powder or in a stabilized buffer containing trehalose (6%) at pH 8.0 to maintain structural integrity during storage and shipping .

How should researchers store and handle the recombinant protein?

Proper storage and handling are critical for maintaining the stability and functionality of recombinant proteins like the Cytochrome b6-f complex subunit 4. Based on recommendations for similar proteins, researchers should follow these guidelines:

  • Upon receipt, briefly centrifuge the vial to ensure all material is at the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage (lyophilized form has a shelf life of approximately 12 months, while liquid form typically lasts 6 months)

  • For working solutions, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as these can compromise protein integrity

Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been reported to enhance stability for similar proteins .

What are common applications of this recombinant protein in research?

The recombinant Cytochrome b6-f complex subunit 4 protein has several valuable applications in research:

  • Immunological studies: The specific and immunogenic properties make it useful for understanding and manipulating immune responses in various experimental contexts

  • Structural biology: As a component of the photosynthetic apparatus, it provides insights into membrane protein structure and organization

  • Functional studies: Investigations of electron transport mechanisms in photosynthesis

  • Evolutionary research: Comparative studies across plant species to understand the evolution of photosynthetic mechanisms

  • Antibody development: Generation of specific antibodies for detection and localization studies

  • Protein-protein interaction studies: Identification of binding partners within the photosynthetic machinery

  • Enzyme kinetics: Analysis of electron transfer rates and mechanisms

The availability of recombinant versions of this protein allows for detailed biochemical and biophysical characterization that would be difficult with native proteins isolated from plant material.

What experimental designs are most appropriate for studying petD function in photosynthetic processes?

When designing experiments to study petD function, researchers should implement robust experimental design principles to ensure valid and reproducible results:

  • Fundamental design considerations:

    • Employ randomization to reduce selection bias in experimental units

    • Implement blinding procedures during data collection and analysis to prevent observer bias

    • Consider factorial designs when investigating multiple variables simultaneously to maximize efficiency and statistical power

    • Include appropriate positive and negative controls for all experimental conditions

  • Functional assays for petD studies:

    • Electron transport measurements using oxygen evolution or chlorophyll fluorescence

    • Spectroscopic analyses of electron transfer kinetics

    • Membrane potential measurements across thylakoid membranes

    • ATP synthesis assays to assess impact on energy production

  • Comparative experimental approaches:

    • In vitro reconstitution with purified components

    • In vivo studies in model plant systems

    • Heterologous expression in bacterial or yeast systems

    • Correlation between in vitro findings and in vivo phenotypes

Researchers should be aware that many studies fail to implement critical design elements such as randomization (87% of studies surveyed) and blinding (86% of studies surveyed), which can significantly impact the validity and reproducibility of results .

How can researchers optimize protein-protein interaction studies involving the petD subunit?

Protein-protein interaction studies with membrane proteins like petD require specialized approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use specific antibodies against petD to pull down protein complexes

    • Identify interaction partners through mass spectrometry

    • Validate using reciprocal pull-downs and western blotting

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by MS/MS

    • Identify interaction interfaces through specialized software analysis

  • Structural approaches:

    • Cryo-electron microscopy of intact complexes

    • X-ray crystallography of co-crystallized components

    • Computational docking informed by experimental constraints

  • Biophysical methods:

    • Surface Plasmon Resonance (SPR) with immobilized petD

    • Microscale Thermophoresis (MST) to measure binding affinities

    • Förster Resonance Energy Transfer (FRET) to assess proximity

  • In vivo validation:

    • Split-protein complementation assays

    • Bimolecular Fluorescence Complementation (BiFC)

    • Co-localization studies using fluorescently tagged proteins

The choice of method should be guided by the specific research question, with consideration of the challenges inherent to membrane protein biochemistry, such as maintaining native-like environments during extraction and analysis.

How does the amino acid sequence of Calycanthus floridus var. glaucus petD compare with other species, and what are the evolutionary implications?

Comparative sequence analysis provides valuable insights into evolutionary relationships and functional conservation of the petD protein:

Table 1: Comparison of petD protein sequences across select species

SpeciesUniProt IDSequence LengthKey Conserved DomainsFunction
Calycanthus floridus var. glaucusQ7YJU7167 aaTransmembrane helices, cofactor binding sitesElectron transport
Emiliania huxleyiQ4G3F7160 aaSimilar transmembrane organizationElectron transport
Mesostigma virideQ9MUV2160 aaConserved functional motifsElectron transport

The petD gene, being chloroplast-encoded, typically evolves more slowly than nuclear genes, making it valuable for deep phylogenetic analyses. To conduct evolutionary studies with petD:

  • Perform multiple sequence alignment to identify conserved regions

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate selection pressures using dN/dS ratios

  • Map sequence variations onto structural models to understand functional implications

These analyses can reveal how photosynthetic mechanisms have evolved across plant lineages and how structural constraints have influenced sequence conservation in this critical component of the electron transport chain.

What approaches can be used to study post-translational modifications of the petD protein?

Post-translational modifications (PTMs) can significantly impact the function, localization, and interactions of the petD protein:

  • Identification strategies:

    • Enrichment approaches for specific PTMs (e.g., phosphopeptide enrichment)

    • High-resolution mass spectrometry for site localization

    • Top-down proteomics for analysis of intact proteoforms

  • Functional characterization:

    • Site-directed mutagenesis to create non-modifiable variants

    • In vitro enzymatic assays comparing modified and unmodified proteins

    • Structural studies to assess conformational changes induced by PTMs

  • Temporal and conditional analysis:

    • Time-course experiments following light transitions

    • Comparison across developmental stages

    • Response to various environmental stressors

  • Quantitative approaches:

    • SILAC, TMT, or label-free quantification

    • Parallel reaction monitoring for targeted quantification

    • Statistical analysis to identify significantly regulated sites

Understanding the PTM landscape provides insights into how photosynthetic complexes are regulated in response to changing environmental conditions and developmental stages.

How can researchers address reproducibility challenges when working with recombinant membrane proteins like petD?

Reproducibility challenges with recombinant membrane proteins can be addressed through systematic approaches:

  • Comprehensive reporting:

    • Document detailed methodologies including expression conditions, purification steps, and buffer compositions

    • Report protein purity, concentration measurement methods, and quality control metrics

    • Include all relevant experimental parameters and statistical analyses

  • Standardization practices:

    • Use consistent sources of reagents and materials

    • Implement standard operating procedures (SOPs)

    • Consider round-robin testing between different laboratories for critical findings

  • Quality control measures:

    • Verify protein identity by mass spectrometry

    • Assess protein homogeneity by size-exclusion chromatography

    • Confirm structural integrity through circular dichroism or thermal shift assays

  • Data management and sharing:

    • Maintain detailed laboratory records

    • Archive raw data and analysis workflows

    • Consider data repositories for sharing primary data

  • Validation approaches:

    • Use multiple orthogonal techniques to verify key findings

    • Include positive and negative controls in all experiments

    • Test findings across different experimental conditions

Addressing these aspects systematically can significantly improve the reproducibility of experiments involving complex recombinant proteins.

What are the latest methodologies for structural analysis of membrane proteins like Cytochrome b6-f complex subunit 4?

Structural analysis of membrane proteins has been revolutionized by recent technological advances:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single particle analysis for high-resolution structure determination

    • Visualization of proteins in near-native environments

    • Resolution of different conformational states within heterogeneous samples

  • Computational approaches:

    • AlphaFold and similar AI-based prediction tools have demonstrated high accuracy for membrane proteins

    • The computational model for Calycanthus floridus var. glaucus petD shows high confidence with a pLDDT score of 92.58

    • Integration of predicted models with experimental constraints

  • Hybrid methods:

    • Integrating data from multiple experimental techniques (X-ray, NMR, SAXS)

    • Molecular dynamics simulations to model protein dynamics

    • Cross-linking mass spectrometry to validate structural models

  • Advanced crystallization methods:

    • Lipidic cubic phase crystallization for membrane proteins

    • Antibody-mediated crystallization to stabilize specific conformations

    • Serial crystallography at X-ray free-electron lasers

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of subunit stoichiometry

    • Identification of bound lipids and cofactors

For the Cytochrome b6-f complex subunit 4, computational structure prediction has already provided high-confidence models, as evidenced by the AlphaFold model with a pLDDT score of 92.58 .

What considerations are important for designing genetic modification studies targeting the petD gene?

Designing genetic modification studies for chloroplast genes like petD requires special considerations:

  • Chloroplast transformation challenges:

    • Develop species-specific chloroplast transformation protocols

    • Address homoplasmy vs. heteroplasmy issues in transformed lines

    • Design appropriate selection markers for chloroplast transformation

  • Target selection strategies:

    • Use comparative sequence analysis to identify conserved vs. variable regions

    • Leverage structural information to target specific functional domains

    • Consider impacts on complex assembly and stability

  • Mutation design approaches:

    • Conservative substitutions to study specific amino acid functions

    • Deletion mutations to assess domain importance

    • Chimeric constructs to investigate species-specific differences

  • Phenotypic analysis methods:

    • Photosynthetic parameter measurements (oxygen evolution, chlorophyll fluorescence)

    • Growth assessments under various light conditions

    • Biochemical analysis of complex assembly and stability

  • Experimental design principles:

    • Implement appropriate controls including wild-type and empty-vector transformants

    • Use randomization and blinding to reduce bias

    • Consider factorial designs to study interactions with environmental factors

The expression of chloroplast genes like petD is often regulated by the binding of nuclear-coded proteins to the mRNA, with binding sites in the 5'-untranslated regions (UTRs) that may be involved in translation suppression until gene splicing is completed . This regulatory complexity should be considered when designing genetic modification studies.

How can researchers optimize experimental conditions when working with Recombinant Calycanthus floridus var. glaucus Cytochrome b6-f complex subunit 4?

Optimizing experimental conditions is crucial for obtaining reliable results with recombinant membrane proteins:

  • Protein solubilization and stability:

    • Test different detergents for solubilization while maintaining native-like structure

    • Optimize protein:detergent ratios

    • Include stabilizing agents such as glycerol (typically 5-50%), specific lipids, or protease inhibitors

  • Buffer optimization:

    • Screen different pH conditions (typically pH 8.0 has been used for similar proteins)

    • Test various salt concentrations

    • Consider including cofactors that might stabilize the protein

  • Storage considerations:

    • Determine optimal storage conditions (typically -20°C/-80°C with cryoprotectants)

    • Establish working conditions (4°C for up to one week)

    • Minimize freeze-thaw cycles

  • Functional assay optimization:

    • Titrate protein concentration to establish linear response ranges

    • Determine appropriate incubation times

    • Validate assay readouts with positive and negative controls

  • Sample handling:

    • Brief centrifugation prior to opening vials

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of glycerol for long-term storage

Systematic optimization and documentation of these parameters ensures reproducibility across experiments and laboratories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.