Recombinant Calycanthus floridus var. glaucus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Calycanthus floridus var. glaucus NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein component of the NAD(P)H dehydrogenase (NDH) complex found in the chloroplasts of Calycanthus floridus var. glaucus, also known as the Eastern sweetshrub . The NDH complex is vital for photosynthetic electron transport in plants .

Function and Significance

The NDH complex facilitates the transfer of electrons from NAD(P)H to quinones, utilizing flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers. This electron transfer chain is crucial in photosynthesis . Specifically, the NDH complex is involved in:

  • Electron Transport: Shuttling electrons from NAD(P)H to plastoquinone within the photosynthetic chain .

  • Redox Balance: Influencing the redox state of the plastoquinone pool by reducing the plastoquinone reservoir in plastoglobules .

  • Metabolism: Participating in prenylquinone metabolism, which includes the synthesis and storage of plastoquinone, plastochromanol-8, phylloquinone (vitamin K1), and tocopherol (vitamin E) .

The NDH complex, with its subunit ndhC, ensures efficient electron flow and maintains the appropriate redox environment required for photosynthesis and related metabolic processes.

Subunit ndhC Characteristics

  • Type II NAD(P)H:quinone oxidoreductases (NDH-2): These enzymes catalyze the two-electron transfer from NAD(P)H to quinones without an energy-transducing site .

  • Cofactors: NDH-2 enzymes typically lack FMN and iron-sulfur clusters but contain a non-covalently bound FAD (Flavin Adenine Dinucleotide) . Some NDH-2 variants may have covalently bound FMN or non-covalently bound FMN instead of FAD .

  • Structural Features: Some NDH-2 enzymes feature two ADP-binding sites and an EF-hand motif that binds calcium .

Role in Plastoquinone Redox State

The NAD(P)H-quinone oxidoreductase, including the ndhC subunit, influences the plastoquinone (PQ) redox state within chloroplasts . Key aspects of this role include:

Involvement in Prenylquinone Metabolism

Plastoglobules store prenylquinones like plastoquinone, plastochromanol-8, phylloquinone (vitamin K1), and tocopherol (vitamin E). NDC1 is essential for the normal accumulation of plastochromanol-8 and the production of vitamin K1 .

NDH Complex Structure

The NDH complex comprises several subunits, including NdhC. Research elucidating the structure of the NDH complex provides insights into the interactions between these subunits.

Experimental Evidence

  • In vitro studies have shown that purified plastoglobules function as a quinone-containing substrate and accept electrons from NADPH and recombinant NDC1 enzyme .

  • In vivo studies with ndc1 mutants show a more oxidized PQ pool compared to wild-type plants .

Potential Applications

Understanding the function of recombinant Calycanthus floridus var. glaucus NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) can potentially be applied in:

  • Enhancing Photosynthesis: Engineering plants with optimized NDH complexes could improve photosynthetic efficiency .

  • Improving Stress Tolerance: Modulating the PQ redox state via NDH activity might enhance plant tolerance to environmental stresses .

  • Biotechnology: Utilizing NDH enzymes in biotechnological applications related to electron transfer and redox reactions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Specify your desired tag type in advance for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPIREGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic and possibly chloroplast respiratory chains. In this species, plastoquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NAD(P)H-quinone oxidoreductase subunit 3 in Calycanthus floridus var. glaucus?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the chloroplast NDH complex in Calycanthus floridus var. glaucus. This protein participates in cyclic electron flow around photosystem I, contributing to photoprotection and optimizing photosynthetic efficiency under various environmental stresses. The ndhC gene is encoded in the chloroplast genome, specifically within the large single copy (LSC) region as confirmed by complete chloroplast genome sequencing studies . The protein functions as an integral membrane subunit within the NDH complex, facilitating electron transfer from NAD(P)H to plastoquinone and generating a proton gradient for ATP synthesis.

How does the chloroplast genome organization of Calycanthus floridus var. glaucus influence ndhC gene expression?

The chloroplast genome of Calycanthus floridus var. glaucus exhibits a quadripartite structure consisting of large single copy (LSC) and small single copy (SSC) regions separated by two inverted repeat (IR) regions. Comparative genomic analyses have revealed that the position of the ndhC gene within the LSC region is relatively conserved among Magnoliaceae species, although IR boundary shifts can affect the expression of nearby genes . The gene context surrounding ndhC, including intergenic regions and neighboring genes, plays a significant role in transcriptional regulation. Notably, the stretching or contraction of IR regions observed in C. floridus var. glaucus compared to related species like Magnolia grandiflora may influence the evolutionary pressure on chloroplast genes including ndhC .

What taxonomic significance does the ndhC gene have for understanding evolutionary relationships in Magnoliidae?

The ndhC gene sequences from Calycanthus floridus var. glaucus serve as important molecular markers for phylogenetic analyses within Magnoliidae. Phylogenetic trees constructed using maximum likelihood (ML) and maximum parsimony (MP) methods based on shared chloroplast genes (including ndhC) from 30 species have provided strong support for the phylogenetic position of Calycanthus within Laurales and its relationship to other early-diverging angiosperms . The conservation pattern of the ndhC gene sequence, along with structural variations in the chloroplast genome organization, offers insights into the evolutionary history and divergence times of basal angiosperm lineages. Comparative analyses of ndhC sequences can reveal selection pressures acting on photosynthetic machinery across different ecological adaptations.

What optimization strategies should be employed in designing experiments for recombinant expression of Calycanthus floridus var. glaucus ndhC?

Optimizing recombinant expression of Calycanthus floridus var. glaucus ndhC requires a systematic approach using Design of Experiments (DoE) methodology rather than inefficient one-factor-at-a-time approaches . Begin by constructing an expression vector containing the ndhC coding sequence optimized for your selected microbial host (typically E. coli or yeast systems). Critical factors requiring optimization include:

  • Expression temperature (20-37°C)

  • Induction time (2-24 hours)

  • Inducer concentration (0.1-1.0 mM IPTG)

  • Media composition (varying nitrogen and carbon sources)

  • Host strain selection

Using response surface methodology (RSM), researchers can identify optimal conditions while revealing interactions between factors that significantly impact protein yield and solubility . For membrane proteins like ndhC, consider fusion tags (such as MBP or SUMO) to enhance solubility, and test multiple detergents during extraction to maintain native conformation. Software packages specifically designed for DoE approaches facilitate experimental design and result analysis, reducing costs and experimental time while improving reproducibility .

How can researchers effectively isolate chloroplasts from Calycanthus floridus var. glaucus for ndhC studies?

Effective isolation of intact chloroplasts from Calycanthus floridus var. glaucus requires careful consideration of plant tissue selection and extraction conditions. The procedure should follow these methodological steps:

  • Collect young leaves (preferably 3-4 weeks old) from healthy C. floridus plants grown under controlled conditions, as these contain higher chloroplast density and less interfering secondary metabolites .

  • Process tissue in ice-cold isolation buffer containing:

    • 0.33 M sorbitol

    • 50 mM HEPES-KOH (pH 7.5)

    • 2 mM EDTA

    • 1 mM MgCl₂

    • 1% BSA

    • 10 mM β-mercaptoethanol

  • Homogenize tissue gently to prevent chloroplast damage, filter through multiple layers of cheesecloth, and centrifuge at 1,000 × g for 10 minutes at 4°C.

  • Purify chloroplasts using Percoll gradient centrifugation (40%/80%) at 3,000 × g for 20 minutes at 4°C.

  • Assess chloroplast integrity through microscopy and confirm enrichment via immunoblotting with antibodies against chloroplast markers such as Rubisco.

This protocol minimizes contamination from other cellular compartments and provides high-quality chloroplasts for subsequent isolation of thylakoid membranes containing the NDH complex.

What are the optimal parameters for PCR amplification of the ndhC gene from Calycanthus floridus var. glaucus chloroplast DNA?

PCR amplification of the ndhC gene from Calycanthus floridus var. glaucus chloroplast DNA requires careful optimization of reaction parameters and primer design. Based on the chloroplast genome structure of related species, the following approach is recommended:

  • Design primers targeting conserved regions flanking the ndhC gene:

    • Forward primer should target sequences 150-200 bp upstream of the ndhC start codon

    • Reverse primer should target sequences 150-200 bp downstream of the stop codon

    • Primer annealing temperatures should be within 2°C of each other

  • Optimize PCR conditions using a temperature gradient:

    • Initial denaturation: 95°C for 3 minutes

    • 30-35 cycles of:

      • Denaturation: 95°C for 30 seconds

      • Annealing: 55-62°C for 30 seconds (identify optimal temperature)

      • Extension: 72°C for 1 minute

    • Final extension: 72°C for 10 minutes

  • Reaction composition:

    • 10-50 ng chloroplast DNA

    • 0.2-0.5 μM each primer

    • 0.2 mM dNTPs

    • 1.5-3.0 mM MgCl₂ (optimize concentration)

    • 1X high-fidelity polymerase buffer

    • 1-2 units high-fidelity DNA polymerase

  • Verify PCR products through gel electrophoresis and confirm identity through sequencing before proceeding to cloning steps for recombinant expression.

The chloroplast genome sequencing approach used for related Magnoliaceae species provides valuable reference information for designing appropriate primers and verifying amplification results .

How can researchers assess the structural integrity and function of recombinant Calycanthus floridus var. glaucus ndhC protein?

Comprehensive assessment of recombinant ndhC structural integrity and function requires integration of biophysical, biochemical, and functional approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

    • Differential scanning calorimetry (DSC) to evaluate thermal stability

    • Intrinsic tryptophan fluorescence measurements to probe tertiary structure

  • Biochemical analysis:

    • SDS-PAGE and native PAGE to assess purity and oligomerization

    • Western blot with anti-ndhC antibodies to confirm identity

    • Limited proteolysis to probe folding integrity

    • Mass spectrometry for accurate molecular weight determination and post-translational modifications

  • Functional assays:

    • NADH/NADPH oxidation rates using spectrophotometric methods

    • Electron transfer efficiency using artificial electron acceptors

    • Reconstitution into liposomes to measure proton pumping activity

    • Comparison with native protein isolated from C. floridus chloroplasts

Researchers should employ experimental design approaches to optimize assay conditions, considering factors such as pH, temperature, ionic strength, and detergent composition . Data from multiple complementary techniques should be integrated to develop a comprehensive understanding of protein structure-function relationships.

What methods can be employed to resolve contradictory findings in ndhC research literature?

Resolving contradictory findings in ndhC research literature requires systematic evidence evaluation and meta-analytical approaches:

  • Implement a natural language inference (NLI) framework to identify genuinely contradictory claims in the literature, distinguishing between real contradictions and apparent inconsistencies due to contextual differences .

  • Conduct structured literature review using the following categorization:

    • Experimental systems used (heterologous expression systems vs. native protein)

    • Analytical methods employed (in vitro vs. in vivo approaches)

    • Environmental conditions examined (light intensities, stress conditions)

    • Genetic backgrounds utilized (wild-type vs. mutant)

  • Apply a standardized quality assessment for each contradictory finding:

    • Methodological rigor and reproducibility

    • Statistical power and appropriate controls

    • Technical validation of results

    • Consistency with established biochemical principles

  • Design critical experiments that directly address contradictions:

    • Reproduce original conditions from conflicting studies

    • Systematically vary key parameters identified as potential sources of discrepancy

    • Employ multiple orthogonal techniques to verify results

  • Integrate findings through meta-analysis:

    • Weight evidence based on methodological quality

    • Identify moderator variables that explain apparent contradictions

    • Develop unified models that accommodate seemingly contradictory observations

How can comparative genomics be used to analyze the evolution of ndhC in Calycanthus floridus var. glaucus relative to other Magnoliidae?

Comparative genomic analysis of ndhC evolution in Calycanthus floridus var. glaucus and related Magnoliidae requires integrated bioinformatic approaches:

  • Sequence acquisition and alignment:

    • Extract ndhC coding sequences and flanking regions from complete chloroplast genomes of Magnoliidae species

    • Perform multiple sequence alignment using MAFFT or T-Coffee algorithms

    • Manually adjust alignments to account for gaps and ensure codon integrity

  • Evolutionary rate analysis:

    • Calculate synonymous (dS) and non-synonymous (dN) substitution rates

    • Identify sites under positive or purifying selection using PAML or HyPhy packages

    • Compare selection patterns across different lineages within Magnoliidae

  • Structural element conservation:

    • Predict transmembrane domains and conserved functional motifs

    • Map sequence conservation onto structural models

    • Identify co-evolving residues using mutual information analysis

  • Genomic context analysis:

    • Examine the position of ndhC relative to IR boundaries across species

    • Analyze gene synteny and rearrangements in the vicinity of ndhC

    • Evaluate the impact of IR contraction/expansion on ndhC evolution

  • Phylogenetic analysis:

    • Construct maximum likelihood and Bayesian phylogenetic trees

    • Test alternative topology hypotheses

    • Perform ancestral sequence reconstruction

Results from these analyses can provide insights into the evolutionary constraints on ndhC function, adaptation to different ecological niches, and the role of chloroplast genome rearrangements in driving ndhC sequence evolution within Magnoliidae .

How can protein engineering be applied to enhance the stability and activity of recombinant Calycanthus floridus var. glaucus ndhC?

Protein engineering of recombinant C. floridus var. glaucus ndhC can be strategically approached through the following methodologies:

  • Structure-guided rational design:

    • Identify conserved residues through multiple sequence alignment with ndhC from diverse species

    • Model the 3D structure using homology modeling based on related NDH complex structures

    • Target residues at subunit interfaces to enhance complex stability

    • Introduce disulfide bridges at strategic positions to increase thermostability

  • Directed evolution strategies:

    • Implement error-prone PCR to generate mutation libraries

    • Develop high-throughput screening systems based on NADPH oxidation activity

    • Apply iterative rounds of selection under increasingly stringent conditions

    • Use Design of Experiments (DoE) to optimize directed evolution parameters

  • Semi-rational approaches:

    • Use computational alanine scanning to identify hotspots for mutagenesis

    • Create focused mutation libraries targeting catalytic residues and membrane interfaces

    • Employ site-saturation mutagenesis at key positions identified from structural analysis

    • Apply consensus design based on sequence analysis of ndhC across phylogenetically diverse species

  • Stability enhancement strategies:

    • Optimize codon usage for expression host

    • Introduce soluble fusion partners and linker optimization

    • Implement surface entropy reduction through lysine/glutamate substitutions

    • Design protein chimeras using stable domains from thermophilic organisms

  • Functional optimization:

    • Modify cofactor binding sites to alter NADH/NADPH preference

    • Engineer electron transfer pathways for enhanced catalytic efficiency

    • Adjust membrane interaction domains for improved stability in detergent environments

The optimization process should employ response surface methodology to identify optimal combinations of mutations that synergistically enhance stability and activity .

What are the implications of ndhC gene variants on photosynthetic efficiency in Calycanthus floridus var. glaucus under various environmental stresses?

The ndhC gene variants in Calycanthus floridus var. glaucus significantly impact photosynthetic efficiency under environmental stresses through several mechanisms:

  • Drought stress response:

    • ndhC variants with enhanced stability maintain cyclic electron flow around photosystem I during water limitation

    • Variants with altered regulatory regions show differential expression patterns during progressive drought

    • Specific amino acid substitutions influence the interaction between ndhC and other NDH complex subunits, affecting proton gradient generation during water deficit

  • Temperature stress adaptation:

    • Cold-responsive elements in ndhC promoter regions control expression during temperature fluctuations

    • Thermostable variants maintain NDH complex integrity at elevated temperatures

    • Amino acid substitutions in transmembrane domains affect membrane fluidity compensation mechanisms

  • Light intensity response:

    • Variants with modified electron transfer kinetics show differential photoprotective capacity under high light

    • Regulatory element variations influence expression level changes during light intensity transitions

    • Structural modifications affecting interactions with ferredoxin impact cyclic electron flow efficiency at varying light intensities

  • CO₂ concentration effects:

    • ndhC sequence variations affect the coordination between NDH-dependent and NDH-independent cyclic electron flow pathways at different CO₂ levels

    • Specific variants show enhanced photosynthetic efficiency under limited CO₂ conditions

Based on comparative studies of chloroplast genome evolution in Magnoliidae, ndhC variation patterns suggest adaptive evolution in response to the specific habitat conditions of Calycanthus floridus var. glaucus in the Appalachian region . These findings have important implications for understanding the molecular basis of photosynthetic adaptations in early-diverging angiosperms.

How can synthetic biology approaches be used to reconstitute functional Calycanthus floridus var. glaucus NDH complexes containing ndhC?

Reconstituting functional NDH complexes containing Calycanthus floridus var. glaucus ndhC through synthetic biology approaches requires systematic assembly and validation strategies:

  • Modular gene assembly:

    • Design synthetic genes for all NDH complex subunits (ndhA-ndhK) with standardized restriction sites and fusion tags

    • Optimize codon usage for expression host while maintaining key regulatory elements

    • Implement Golden Gate or Gibson Assembly for efficient multi-gene construct creation

    • Design polycistronic expression cassettes with optimized ribosome binding sites and spacing

  • Expression system optimization:

    • Test combinations of promoters, terminators, and regulatory elements using DoE approaches

    • Develop inducible systems with fine-tuned expression control

    • Implement dual-plasmid systems separating membrane and soluble components

    • Design specialized strains with modified membrane composition

  • Assembly validation and characterization:

    • Implement fluorescent protein fusions for visualizing complex assembly

    • Develop split reporter systems to monitor protein-protein interactions

    • Apply cryo-electron microscopy to verify structural integrity

    • Utilize native mass spectrometry to confirm subunit stoichiometry

  • Functional reconstitution strategies:

    • Develop in vitro translation systems with co-translational membrane insertion

    • Optimize detergent-mediated extraction and reconstitution into liposomes

    • Engineer protocells with minimal components for NDH function

    • Design synthetic thylakoid membrane mimics with controlled lipid composition

  • Integration with other photosynthetic components:

    • Couple reconstituted NDH complexes with photosystem I components

    • Establish artificial electron transport chains with defined components

    • Develop minimal systems for measuring proton pumping and ATP synthesis

This synthetic biology approach provides a powerful platform for understanding the structure-function relationships of ndhC and testing hypotheses about NDH complex assembly and regulation that are difficult to address in native systems.

What strategies can overcome common challenges in solubilizing and purifying recombinant Calycanthus floridus var. glaucus ndhC protein?

Membrane proteins like ndhC present significant challenges for solubilization and purification. The following strategies can overcome common obstacles:

  • Optimized solubilization approach:

    Detergent ClassExamplesConcentration RangeBest Applications
    NonionicDDM, OG1-2% (w/v)Initial screening
    ZwitterionicLDAO, FC-120.5-1% (w/v)Improved stability
    AmphipolsA8-351:3 (protein:amphipol)Detergent-free systems
    NanodiscsMSP1D11:2:60 (protein:MSP:lipid)Native-like environment
    SMALPsSMA copolymer2.5% (w/v)Direct membrane extraction
  • Expression system modifications:

    • Fusion with solubility-enhancing partners (MBP, SUMO, Mistic)

    • Directed evolution for improved expression and solubility

    • Co-expression with chaperones and NDH complex partners

    • Use of specialized expression hosts with modified membrane composition

  • Purification optimization:

    • Implement two-step affinity chromatography with orthogonal tags

    • Develop mild elution conditions to maintain structural integrity

    • Apply size exclusion chromatography in detergent-containing buffers

    • Utilize ion exchange chromatography at pH values away from protein pI

  • Stability enhancement during purification:

    • Include specific lipids (POPE, POPG) to stabilize native conformation

    • Add glycerol (10-15%) and reducing agents to prevent aggregation

    • Maintain consistent temperature throughout purification process

    • Test protease inhibitor cocktails to prevent degradation

  • Quality control metrics:

    • Implement thermal shift assays to monitor protein stability

    • Use dynamic light scattering to detect aggregation

    • Apply circular dichroism to verify secondary structure integrity

    • Develop functional assays to confirm activity throughout purification

These approaches should be systematically tested using DoE methodology to identify optimal conditions specific to C. floridus var. glaucus ndhC .

How can researchers address challenges in analyzing contradictory data on ndhC function across different experimental systems?

Addressing contradictory data on ndhC function requires a systematic framework for evaluating research findings and resolving apparent discrepancies:

  • Analytical framework development:

    • Implement natural language inference models to identify truly contradictory claims in literature

    • Develop standardized metadata templates for experimental conditions

    • Create ontology-based annotation systems for ndhC functional studies

    • Establish minimum reporting standards for NDH complex research

  • Experimental system comparison:

    System TypeAdvantagesLimitationsBest Applications
    Heterologous expressionControlled conditions, high yieldMay lack native interactionsInitial characterization
    Native chloroplastsComplete native contextComplex background, lower yieldPhysiological validation
    Reconstituted membranesDefined compositionArtificial environmentMechanistic studies
    In vivo mutant analysisPhysiological relevanceCompensatory mechanismsWhole-plant function
  • Statistical approaches for resolving contradictions:

    • Apply Bayesian hierarchical modeling to integrate data across studies

    • Conduct sensitivity analyses to identify influential experimental parameters

    • Develop meta-regression models to explain heterogeneity across studies

    • Implement machine learning approaches to predict conditions leading to contradictory results

  • Experimental validation strategies:

    • Design critical experiments targeting specific contradictions

    • Systematically vary key parameters identified in contradictory studies

    • Apply multiple orthogonal techniques to verify findings

    • Collaborate across laboratories to reproduce key findings

  • Knowledge synthesis approach:

    • Develop mechanistic models that can accommodate apparently contradictory observations

    • Identify contextual factors that explain differential ndhC function

    • Create decision frameworks for selecting appropriate experimental systems

    • Establish consensus guidelines for interpreting ndhC functional data

By systematically evaluating the source and nature of contradictions, researchers can develop more robust understanding of ndhC function that integrates findings across diverse experimental approaches .

What quality control measures ensure the reliability of recombinant Calycanthus floridus var. glaucus ndhC protein for structural and functional studies?

Implementing comprehensive quality control measures for recombinant ndhC ensures reliable structural and functional characterization:

  • Expression and purification quality control:

    • SDS-PAGE with densitometry to assess purity (target: >95%)

    • Western blot with anti-ndhC antibodies to confirm identity

    • Mass spectrometry for accurate molecular weight and post-translational modification analysis

    • N-terminal sequencing to verify intact protein

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal shift assays to evaluate stability across purification batches

    • Limited proteolysis patterns to verify consistent folding

    • Dynamic light scattering to detect aggregation and assess monodispersity

  • Functional validation:

    Assay TypeParameter MeasuredAcceptance CriteriaControls
    NADH oxidationEnzyme activityCV < 15% between batchesHeat-inactivated enzyme
    Electron transferETR to quinones>70% of native activityInhibitor controls
    ReconstitutionComplex assemblyConsistent subunit stoichiometryIndividual components
    Proton pumpingpH gradient formationSignal:noise > 3:1Uncoupler controls
  • Batch-to-batch consistency monitoring:

    • Implement statistical process control for key quality attributes

    • Maintain reference standards from verified functional batches

    • Develop quantitative acceptance criteria for each quality parameter

    • Design stability indicating assays for storage condition optimization

  • Documentation and traceability:

    • Maintain detailed records of expression conditions and purification procedures

    • Document all quality control test results with raw data

    • Implement lot release criteria based on critical quality attributes

    • Establish a change control system for production modifications

By applying Design of Experiments approaches to quality control method development, researchers can identify critical parameters affecting ndhC quality and implement efficient testing strategies that ensure reliable protein for downstream applications .

What are the emerging research frontiers for Calycanthus floridus var. glaucus ndhC in understanding early angiosperm evolution?

The study of Calycanthus floridus var. glaucus ndhC presents significant opportunities for advancing our understanding of early angiosperm evolution and photosynthetic adaptation. As a member of Calycanthaceae within the basal angiosperm order Laurales, C. floridus var. glaucus offers unique insights into the evolutionary trajectory of photosynthetic machinery in early flowering plants. The chloroplast-encoded ndhC gene and its protein product serve as molecular markers for tracing evolutionary relationships and adaptation mechanisms.

Comparative genomic analyses between C. floridus var. glaucus and other Magnoliidae members have revealed significant patterns in chloroplast genome evolution, including variations in inverted repeat boundaries that affect gene content and organization . The ndhC gene's sequence conservation patterns, coupled with its functional importance in cyclic electron flow, provide a window into how early angiosperms optimized photosynthetic efficiency across diverse ecological niches.

Future research should focus on integrating molecular evolution analyses with structural biology approaches to understand how ndhC sequence variations translate to functional adaptations in the NDH complex. Additionally, expanding comparative studies to include more basal angiosperm lineages will help reconstruct the ancestral state of photosynthetic machinery and trace its diversification across evolutionary history.

How might advances in structural biology techniques impact our understanding of ndhC function in the NDH complex?

Integration of structural data with functional assays using recombinant systems will enable structure-function correlations that identify critical residues for electron transfer, proton pumping, and complex assembly. This integrated approach will provide a comprehensive understanding of how ndhC sequence variations observed in evolutionary studies translate to functional differences in photosynthetic efficiency across diverse environmental conditions.

What potential applications exist for engineered variants of Calycanthus floridus var. glaucus ndhC in enhancing photosynthetic efficiency?

Engineered variants of Calycanthus floridus var. glaucus ndhC offer promising applications for enhancing photosynthetic efficiency in both native and heterologous systems. Strategic modifications to ndhC can optimize cyclic electron flow around photosystem I, potentially increasing ATP production without corresponding increases in NADPH, thereby improving energy balance under stress conditions.

Specific engineering targets include modifying regulatory elements to enhance expression under stress conditions, altering amino acid residues at electron transfer interfaces to improve catalytic efficiency, and introducing stability-enhancing mutations to maintain function under extreme temperatures. These approaches can be implemented through directed evolution protocols and rational design strategies based on structural insights .

Transferring optimized ndhC variants to agricultural crops represents a long-term application with potential impacts on yield stability under adverse conditions. Enhanced cyclic electron flow mediated by improved ndhC function could increase plant resilience to drought, high light, and temperature fluctuations—conditions increasingly prevalent due to climate change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.