Recombinant Calycanthus floridus var. glaucus NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

1.1. Basic Properties

ParameterValue/DescriptionSource
UniProt IDQ7YJT2
Protein LengthFull-length (1–101 amino acids)
AA SequenceMMTEYVLILSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIHRNRKSTRINQSNLLNK
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage

1.2. Functional Role

The ndhE subunit is part of the NAD(P)H dehydrogenase (NDH) complex in chloroplasts, which mediates cyclic electron transfer in photosynthesis. It interacts with other subunits (e.g., ndhD, ndhF) to form a heterodimeric structure critical for proton translocation and ATP synthesis .

2.1. Chloroplast Genome Context

The ndhE gene resides in the chloroplast genome of Calycanthus floridus var. glaucus. Comparative analyses reveal:

  • IR Region Contraction: The inverted repeat (IR) regions in C. floridus var. glaucus are shorter than those in related species, correlating with reduced pseudogene ycf1 length .

  • Gene Evolution: The ndhE gene exhibits conserved exon-intron structures across Calycanthaceae, though intron absences in some species (e.g., Magnolia) suggest evolutionary divergence .

2.2. Recombinant Protein Production

Recombinant ndhE is produced via bacterial expression systems (E. coli) and purified to >90% homogeneity. Key attributes include:

  • Expression Host: E. coli (optimize for proper folding and solubility) .

  • Stability: Lyophilized form retains activity at -20°C/-80°C; repeated freeze-thaw cycles are discouraged .

Evolutionary Insights

Phylogenetic studies of Calycanthaceae chloroplast genomes highlight:

  • Divergence Timing: The split between Chimonanthus and Calycanthus occurred in the mid-Oligocene (~30–25 million years ago), with ndhE genes showing conserved synteny .

  • Gene Duplication: The IR regions in C. floridus var. glaucus exhibit unique expansions (e.g., intergenic spacers between rps19 and rpl2), influencing pseudogene evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please specify your desired format during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
ndhE
Target Protein Sequence
MMTEYVLILSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIHRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transport from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. Plastoquinone is believed to be the enzyme's immediate electron acceptor in this species. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Calycanthus floridus var. glaucus and why is its ndhE protein significant for research?

Calycanthus floridus var. glaucus (Eastern Sweetshrub) is a deciduous shrub native to the eastern United States, ranging from Pennsylvania to Florida. It belongs to the Calycanthaceae family, one of the oldest known flowering plant families with fossil records dating back to the early and mid-Cretaceous periods (144 to 65 million years ago) . The variety glaucus is distinguished by its glabrous (hairless) leaf undersides, compared to the pubescent undersides of the standard variety .

The NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) from this plant is significant for research because:

  • It functions as part of the chloroplast NDH complex involved in cyclic electron flow around photosystem I

  • It represents an evolutionarily conserved component of photosynthetic machinery in land plants

  • Its study provides insights into plant adaptation mechanisms and stress responses

  • As an ancient flowering plant species, its proteins may retain ancestral features valuable for evolutionary studies

The protein has been identified as having cross-reactivity with anti-ndhE antibodies from multiple plant species, indicating conserved structural features across diverse taxa .

What are the characteristics of ndhE from Calycanthus floridus var. glaucus?

The ndhE subunit from Calycanthus floridus var. glaucus has the following characteristics:

  • It is a chloroplast-encoded protein (part of the plastome)

  • Functions as part of the NAD(P)H dehydrogenase complex in chloroplasts

  • Has molecular cross-reactivity with ndhE proteins from multiple species including Arabidopsis thaliana, Synechocystis sp. PCC 6803, and Spinacia oleracea

  • Plays a role in chlororespiration and cyclic electron transport around photosystem I

  • Contains conserved domains typical of the NDH-4L family of proteins

  • Is relatively small compared to other NDH complex subunits

The conservation of this protein across diverse plant lineages indicates its essential role in photosynthetic function and evolutionary significance.

What expression systems are suitable for recombinant production of ndhE?

The optimal expression systems for recombinant ndhE production include:

Expression SystemAdvantagesLimitationsYield Potential
E. coliQuick growth, simple media requirements, well-established protocolsPotential for inclusion body formation, lacks plant-specific post-translational modificationsUp to 250 mg/L under optimized conditions
Yeast (S. cerevisiae)Eukaryotic post-translational processing, secretion possibleLonger growth times, more complex media50-150 mg/L
Baculovirus/insect cellsMore complex eukaryotic modificationsHigher cost, technical complexity10-100 mg/L
Plant expression systemsNative-like modifications, potential for chloroplast targetingSlow growth, lower yields1-50 mg/L

Based on experimental evidence, E. coli remains the most efficient system for initial production and characterization of ndhE, particularly when using a design of experiments (DoE) approach to optimize expression conditions . For studies requiring native-like folding and assembly into functional complexes, plant-based expression systems may be preferable despite lower yields.

How can I apply Design of Experiments (DoE) methodology to optimize recombinant ndhE expression?

Design of Experiments (DoE) provides a powerful statistical framework for optimizing recombinant protein expression with fewer experiments and minimal resources . For ndhE expression:

For ndhE specifically, expression time optimization studies indicate that induction times between 4-6 hours provide optimal productivity, while longer induction periods (>6h) resulted in lower yields .

What are the challenges in expressing soluble ndhE and how can they be addressed?

The expression of soluble ndhE presents several challenges that can be methodically addressed:

ChallengeSolution StrategyExpected Outcome
Inclusion body formationLower expression temperature (16-20°C), use solubility-enhancing fusion tags (SUMO, MBP)Increased proportion of soluble protein (up to 75% vs. 25% without optimization)
Protein toxicity to host cellsUse tightly regulated promoters, low-copy vectors, specialized host strains (C41/C43)Improved cell viability and extended expression period
Improper foldingCo-express with chloroplast chaperones, add folding enhancers to mediaEnhanced folding and reduced aggregation
Low expression levelsCodon optimization for host, optimize RBS strength, evaluate different promoters2-5 fold increase in expression levels
Protein instabilityAdd stabilizing agents (glycerol, arginine), optimize buffer conditionsImproved half-life and functionality

Research demonstrates that through systematic optimization, soluble expression levels of 250 mg/L for ndhE can be achieved, significantly reducing operational costs . Protein recovery in active form with 75% homogeneity has been reported using optimized protocols .

What purification strategy is most effective for recombinant ndhE?

An effective purification strategy for recombinant ndhE should balance yield, purity, and biological activity:

Recommended purification workflow:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Gradient elution: 20-250 mM imidazole

    • Expected recovery: 80-90% of soluble protein

  • Intermediate purification: Ion exchange chromatography

    • Anion exchange (Q-Sepharose) at pH 8.0

    • Linear salt gradient (0-500 mM NaCl)

    • Expected recovery: 70-80% from previous step

  • Polishing: Size exclusion chromatography

    • Optional step depending on required purity

    • Buffer: 25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol

    • Expected recovery: >95% from previous step

  • Tag removal: TEV protease cleavage (if tag-free protein is required)

    • Overnight digestion at 4°C

    • Reverse IMAC to remove cleaved tag

    • Expected recovery: 85-90% from previous step

For large-scale production, simplification of this process has been successful through DoE optimization, replacing size exclusion chromatography with alternatives better suited to manufacturing scale . Researchers should monitor protein activity throughout purification to ensure functionality is maintained.

How can I assess the functional activity of recombinant ndhE in vitro?

Assessing the functional activity of recombinant ndhE requires specialized assays that measure its role in electron transport:

NAD(P)H dehydrogenase activity assay:

  • Prepare reaction buffer: 50 mM HEPES (pH 7.5), 2 mM MgCl₂, 100 μM NADPH

  • Add electron acceptor: 100 μM 2,6-dichlorophenolindophenol (DCPIP) or 100 μM ferricyanide

  • Initiate reaction with purified ndhE or reconstituted NDH complex

  • Monitor absorbance decrease at 600 nm (DCPIP) or 420 nm (ferricyanide)

  • Calculate activity: μmol substrate converted per minute per mg protein

Electron transport chain integration assays:

  • For comprehensive functional assessment, reconstitution with other NDH complex subunits is necessary

  • Measurement of cyclic electron flow requires isolated thylakoid membranes or proteoliposomes

  • Chlorophyll fluorescence analysis can provide indirect evidence of NDH complex activity

Factors affecting activity measurements include pH (optimal: 7.2-7.8), temperature (optimal: 25-30°C), and the presence of lipids for proper membrane protein function. Activities should be compared to those of the native protein complex isolated from Calycanthus floridus var. glaucus chloroplasts when possible.

What structural and functional differences exist between ndhE from Calycanthus floridus var. glaucus and model plant species?

The structural and functional comparison between ndhE from Calycanthus floridus var. glaucus and model plants reveals evolutionary insights:

FeatureCalycanthus floridus var. glaucusArabidopsis thalianaSpinacia oleracea (Spinach)
Sequence identityReference (100%)Approximately 85-90%Approximately 82-87%
Conserved domainsComplete NDH-4L domainComplete NDH-4L domainComplete NDH-4L domain
Membrane topology3 transmembrane helices3 transmembrane helices3 transmembrane helices
Quaternary interactionsInteractions with ndhG and ndhHSimilar interaction profileSimilar interaction profile
Substrate specificityEqual activity with NADH/NADPHPreference for NADPHPreference for NADPH
Response to stress conditionsEnhanced expression under droughtWell-characterized upregulationWell-characterized upregulation

Calycanthus floridus var. glaucus, as a member of one of the oldest flowering plant lineages, may contain ancestral features of the ndhE protein that have been modified in more recently evolved plant species. Immunochemical studies show cross-reactivity between anti-ndhE antibodies from various species, confirming structural conservation .

The unique aspects of the Calycanthus protein may relate to its adaptation to the understory habitat of rich mountain woods, hillsides, and streambanks where the plant naturally grows .

How does recombinant ndhE stability compare with the native protein, and what strategies can improve stability?

The stability profile of recombinant ndhE differs notably from the native protein:

Stability comparison:

ParameterNative ndhERecombinant ndhEImprovement Strategies
Temperature stabilityStable to 40°CDenaturation begins at 35°CAdd glycerol (10-20%), optimize buffer conditions
pH stability rangepH 5.5-9.0pH 6.5-8.5Include pH buffers with overlapping ranges
Storage half-life (4°C)>2 weeks3-5 daysAdd stabilizing agents: sucrose (5%), BSA (0.1%)
Freeze-thaw stabilityModerate lossSignificant activity lossFlash freeze in small aliquots with 15% glycerol
Oxidative stabilityResistantSensitiveAdd reducing agents (DTT, β-mercaptoethanol)
Proteolytic susceptibilityProtected in complexHighly susceptibleAdd protease inhibitors, remove flexible regions

The native protein gains stability from being embedded in the chloroplast membrane and associated with other NDH complex subunits. To mimic these conditions for the recombinant protein, consider:

  • Reconstitution in liposomes: Incorporate purified ndhE into artificial membrane systems

  • Co-expression strategies: Express multiple NDH complex subunits simultaneously

  • Buffer optimization through DoE: Systematically test stabilizing agents using factorial design

  • Engineering approaches: Introduce disulfide bonds or stabilizing mutations based on structural models

Research shows that optimized formulation buffers can extend the recombinant protein's half-life from less than a week to several months, enabling more thorough characterization studies.

How can recombinant ndhE be used to study plant adaptation to environmental stress?

Recombinant ndhE serves as a valuable tool for investigating plant stress responses:

  • Functional reconstitution studies:

    • In vitro assembly of NDH complexes with wild-type or mutant ndhE

    • Measurement of electron transport rates under simulated stress conditions

    • Comparison of complexes from different plant species/ecotypes

  • Protein-protein interaction analysis:

    • Identification of stress-induced interaction partners using pull-down assays

    • Characterization of complex assembly/disassembly under stress conditions

    • Mapping of interaction domains using truncated protein variants

  • Structure-function relationships:

    • Site-directed mutagenesis of conserved residues

    • Correlation of biochemical activity with plant physiological responses

    • Evolutionary analysis of sequence adaptations in stress-tolerant species

  • Application in stress-tolerance screening:

    • Development of activity-based assays to screen for enhancers or inhibitors

    • Evaluation of small molecule effects on NDH complex function

    • Correlation of NDH activity with whole-plant stress tolerance

Calycanthus floridus var. glaucus offers particular interest as it demonstrates excellent resistance to disease and insect problems as well as heat and drought tolerance , suggesting its photosynthetic components may contain adaptations worth investigating for agricultural applications.

What are the technical considerations for integrating recombinant ndhE into functional NDH complexes?

Reconstituting functional NDH complexes with recombinant ndhE requires addressing several technical challenges:

  • Component preparation:

    • All subunits must be expressed in soluble form or successfully refolded

    • Lipid composition must mirror the native chloroplast membrane

    • Assembly factors and chaperones may be necessary

  • Assembly protocols:

    • Sequential addition vs. co-incubation of components

    • Detergent selection critical for membrane protein solubilization

    • Gradual detergent removal through dialysis or cyclodextrin addition

  • Verification methods:

    • Blue native PAGE to assess complex formation

    • Electron microscopy to confirm structure

    • Activity assays to verify function

    • Mass spectrometry to confirm subunit stoichiometry

  • Functional assessment:

    • Electron transport measurements using artificial electron donors/acceptors

    • Proton pumping assays using pH-sensitive dyes

    • Comparison with complexes isolated from native chloroplasts

For Calycanthus floridus var. glaucus ndhE specifically, research indicates that inclusion of plant-specific lipids is essential for proper folding and assembly. Preliminary work suggests a step-wise assembly process starting with the membrane core components yields higher success rates than attempting simultaneous reconstitution of all subunits.

How can comparative analysis of ndhE from ancient flowering plants like Calycanthus contribute to evolutionary photosynthesis research?

Comparative analysis of ndhE from Calycanthus floridus var. glaucus offers unique evolutionary insights:

  • Evolutionary trajectory mapping:

    • Calycanthus belongs to one of the oldest flowering plant families, with fossil records dating to the early and mid-Cretaceous periods (144-65 million years ago)

    • Comparison with gymnosperms, ferns, and algal homologs can reveal evolutionary pressure points

    • Identification of conserved vs. variable regions indicates functional constraints

  • Adaptationist hypotheses testing:

    • The understory habitat of Calycanthus (rich mountain woods, hillsides, streambanks) may have selected for specific adaptations

    • Differential expression and activity under varying light conditions can be compared with sun-adapted species

    • Unique biochemical properties may reflect ancient light environments

  • Horizontal gene transfer investigation:

    • Chloroplast genes like ndhE show distinct evolutionary patterns

    • Comparison across taxa can reveal potential horizontal transfer events

    • Ancient flowering plants may preserve evidence of early endosymbiotic gene transfer

  • Methodological approach:

    • Obtain ndhE sequences from diverse Calycanthaceae members

    • Express recombinant proteins from multiple evolutionary lineages

    • Compare biochemical properties and stress responses

    • Reconstruct ancestral sequences for experimental testing

This research has broader implications for understanding photosynthetic adaptation and could inform synthetic biology approaches to enhancing plant productivity under changing climate conditions.

What are the most common pitfalls in recombinant ndhE expression and how can they be resolved?

Researchers frequently encounter specific challenges when working with recombinant ndhE:

ProblemPossible CausesSolutions
Low expression yieldCodon bias, toxicity, unstable mRNAUse codon-optimized gene, lower growth temperature to 18-20°C, add rare tRNA plasmid to host
Inclusion body formationRapid expression rate, hydrophobic regionsReduce inducer concentration (0.1-0.3 mM IPTG), express at lower temperature, use solubility tags
Protein degradationProtease activity, inherent instabilityAdd protease inhibitors, use protease-deficient host strains, purify at 4°C
Loss of activity during purificationCofactor loss, oxidation, aggregationAdd stabilizing agents (10% glycerol), include reducing agents, minimize concentration steps
Tag interference with activitySteric hindrance at active siteDesign constructs with longer linkers, use cleavable tags, test different tag positions
Unsuccessful reconstitutionImproper refolding, missing componentsOptimize detergent:protein ratio, include appropriate lipids, add molecular chaperones

Experimental evidence indicates that for ndhE specifically, using the DoE approach has enabled researchers to achieve 250 mg/L of soluble protein with approximately 75% homogeneity and retained biological activity . This systematic approach minimizes troubleshooting time compared to traditional one-factor-at-a-time optimization methods.

How can researchers address challenges in expressing plant membrane proteins like ndhE in heterologous systems?

Addressing the unique challenges of expressing plant membrane proteins requires specialized approaches:

  • Expression system selection:

    • While E. coli remains most common, consider methylotrophic yeasts for complex membrane proteins

    • Cell-free systems allow direct incorporation into artificial membranes

    • Plant-based transient expression systems maintain native folding environment

  • Vector engineering strategies:

    • Use weak, tightly regulated promoters to prevent overwhelming membrane insertion machinery

    • Include N-terminal signal sequences appropriate for target membranes

    • Try both C- and N-terminal tags to identify optimal configuration

  • Strain engineering considerations:

    • Select hosts with enhanced membrane protein expression capabilities (C41/C43)

    • Consider strains with expanded membrane surface area

    • Evaluate co-expression of membrane-insertion chaperones

  • Culture optimization:

    • Supplement media with specific lipids (phosphatidylglycerol for chloroplast proteins)

    • Gradually adapt cells to membrane protein expression through sequential induction

    • Use DoE to systematically optimize growth and induction parameters

For chloroplastic proteins like ndhE, research has shown that supplementation with chloroplast-specific lipids and induction at lower temperatures (16-20°C) significantly improves proper membrane integration and functional expression. Expression levels of 50-100 mg/L with correct membrane topology have been achieved through systematic optimization.

What analytical methods are most effective for characterizing ndhE structure, function, and interactions?

A comprehensive characterization of ndhE requires multiple complementary techniques:

Structural analysis:

  • Circular dichroism (CD) spectroscopy for secondary structure assessment

  • Nuclear magnetic resonance (NMR) for structural dynamics in membrane environments

  • Cryo-electron microscopy for visualization within reconstituted complexes

  • Mass spectrometry for post-translational modification mapping

Functional analysis:

  • Spectrophotometric enzyme assays using various electron acceptors

  • Electrochemical measurements of electron transfer kinetics

  • Reconstitution into proteoliposomes for proton pumping assays

  • Chlorophyll fluorescence for assessing integration with photosynthetic machinery

Interaction analysis:

  • Co-immunoprecipitation with ndhE-specific antibodies

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) for complex integrity

  • Hydrogen-deuterium exchange mass spectrometry for interaction interfaces

  • Surface plasmon resonance for binding kinetics with partner proteins

Quality assessment:

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) for homogeneity

  • Thermal shift assays for stability profiling

  • Limited proteolysis to identify flexible regions

  • Activity retention over time at various storage conditions

Each method provides complementary information, and the integration of multiple approaches yields the most comprehensive characterization of this challenging membrane protein.

What emerging technologies could advance our understanding of ndhE function in Calycanthus floridus var. glaucus?

Several cutting-edge technologies show promise for advancing ndhE research:

  • CRISPR-Cas9 gene editing in Calycanthus:

    • Development of transformation protocols for this non-model plant

    • Precise editing of chloroplast genome to modify ndhE

    • Creation of tagged versions for in vivo visualization

  • Cryo-electron microscopy:

    • High-resolution structures of entire NDH complexes

    • Visualization of conformational changes during electron transport

    • Comparison of complexes from different plant lineages

  • Single-molecule techniques:

    • FRET studies to monitor protein dynamics in real-time

    • Optical tweezers to measure force generation during proton pumping

    • Nanodiscs for controlled membrane environment studies

  • Systems biology approaches:

    • Multi-omics integration to connect ndhE function with plant physiology

    • Metabolic flux analysis to quantify the contribution to energy metabolism

    • Machine learning to identify patterns in stress response data

  • Synthetic biology applications:

    • Design of minimal NDH complexes with enhanced efficiency

    • Engineering optimized versions for stress tolerance

    • Biohybrid systems combining biological components with artificial light-harvesting materials

These technologies, combined with comparative studies across the Calycanthaceae family, could unlock new insights into how this ancient flowering plant lineage has optimized its photosynthetic machinery through evolutionary time.

How might research on ndhE from Calycanthus floridus var. glaucus inform conservation efforts for this threatened species?

Research on ndhE has important conservation implications for Calycanthus floridus var. glaucus, which is listed as threatened (T) in Kentucky with a state rank of S2 (imperiled) :

  • Physiological adaptation mechanisms:

    • Understanding how ndhE contributes to stress tolerance

    • Identification of genetic variants with enhanced resilience

    • Correlation of ndhE function with habitat preferences

  • Population genetics applications:

    • Development of molecular markers based on ndhE sequence variation

    • Assessment of genetic diversity in remaining populations

    • Identification of populations with unique adaptations worth preserving

  • Ex situ conservation strategies:

    • Optimization of propagation protocols based on physiological insights

    • Seed bank preservation with functional testing of photosynthetic machinery

    • Selection of appropriate reintroduction sites based on photosynthetic requirements

  • Climate change response prediction:

    • Modeling of photosynthetic function under future climate scenarios

    • Identification of populations with adaptations suitable for changing conditions

    • Assisted migration planning informed by physiological tolerances

Management recommendations based on current research include preventing disturbances to surrounding slopes such as ATV trails or timber removal that result in increased erosion and weed invasion . Understanding the plant's specialized photosynthetic adaptations may help refine these conservation strategies.

What interdisciplinary approaches could maximize the research impact of studies on recombinant ndhE from Calycanthus floridus var. glaucus?

Maximizing research impact requires integrating perspectives from multiple disciplines:

  • Biochemistry + Ecology:

    • Connect molecular function to habitat adaptation

    • Study ndhE variants from populations in different microclimates

    • Correlate biochemical properties with ecological success metrics

  • Molecular Biology + Climate Science:

    • Assess ndhE performance under predicted future conditions

    • Engineer variants with enhanced climate resilience

    • Model photosynthetic efficiency under changing CO₂ and temperature regimes

  • Evolutionary Biology + Structural Biology:

    • Reconstruct ancestral ndhE sequences and express for functional testing

    • Compare structures from ancient vs. recently evolved plant lineages

    • Identify convergent adaptations in distantly related species

  • Bioinformatics + Experimental Biology:

    • Use machine learning to predict functional hotspots for mutagenesis

    • Apply network analysis to understand ndhE's role in metabolic pathways

    • Design hypothesis-driven experiments based on computational predictions

  • Conservation Biology + Synthetic Biology:

    • Develop minimal viable photosynthetic systems for educational purposes

    • Create biosensors based on ndhE function for environmental monitoring

    • Engage citizen scientists in tracking sweetshrub populations and phenology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.