Recombinant Calycanthus floridus var. glaucus Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
ycf4
Target Protein Sequence
MNWRSERIWIELITGSRKTSNFCWACILFLGSLGFLLVGTSSYLGRNLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRF LMRDIQSIRMEVKGGLYSRRVLYMEIRGQGAIPLTRTDENFTPREIEQKAAELAYFLRVP IELK
Uniprot No.

Target Background

Function
Plays a crucial role in the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Ycf4 in photosynthetic organisms?

Ycf4 is a thylakoid membrane protein that plays an essential role in the accumulation and assembly of photosystem I (PSI) complexes in photosynthetic organisms. Research indicates that Ycf4 is critical for PSI assembly, as demonstrated in studies where its absence significantly impacts PSI complex formation . The protein functions as part of a large molecular assembly complex exceeding 1500 kD in size, where it appears to facilitate the incorporation of newly synthesized PSI subunits into functional PSI complexes . Pulse-chase protein labeling experiments have revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, suggesting Ycf4's role in the early stages of PSI assembly .

While the protein is absolutely essential for PSI accumulation in some organisms like Chlamydomonas reinhardtii, studies in cyanobacteria have shown that mutants deficient in Ycf4 can still assemble PSI complexes, albeit at reduced levels . This difference suggests evolutionary adaptations in the PSI assembly process across different photosynthetic lineages, with Ycf4 potentially playing more critical roles in higher plants and green algae compared to cyanobacteria.

How is the ycf4 gene organized in the chloroplast genome?

The ycf4 gene is located in the chloroplast genome as part of a polycistronic transcriptional unit. In Chlamydomonas reinhardtii, the gene exists within the rps9-ycf4-ycf3-rps18 cluster . While the specific organization in Calycanthus floridus var. glaucus is not explicitly detailed in the provided search results, chloroplast genomic studies in related species can provide insights into its likely arrangement.

In many plant species, the gene organization in the chloroplast genome is relatively conserved, particularly for genes involved in photosynthetic functions. The ycf4 gene is typically positioned in the large single-copy (LSC) region of the chloroplast genome, and its expression is regulated along with other photosynthesis-related genes. The chloroplast genome organization is particularly important for understanding gene expression regulation and evolutionary relationships between photosynthetic organisms.

Comparative genomic studies, like those performed on Magnolia grandiflora's chloroplast genome, have shown that gene order and organization in the chloroplast genomes of Magnoliaceae species (taxonomically related to Calycanthaceae, which includes Calycanthus) can provide valuable information about evolutionary relationships and functional adaptations .

What are the most effective methods for isolating and purifying Ycf4-containing complexes?

Isolating Ycf4-containing complexes requires specialized techniques due to their large size (>1500 kD) and membrane association. One of the most effective approaches documented is tandem affinity purification (TAP) tag technology . This method involves genetically engineering the organism to express a TAP-tagged version of Ycf4, which allows for a two-step affinity purification process.

The TAP-tag typically consists of a calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site . This genetic modification enables highly specific purification while maintaining the protein's native functionality. Research has shown that fusion of the TAP-tag to the C-terminus of Ycf4 does not significantly affect its function or structure, making it an ideal approach for studying Ycf4-containing complexes .

After cell lysis, the purification process typically involves:

  • Initial capture using IgG affinity chromatography (binding to the Protein A domain)

  • Protease treatment to cleave the tag at the specified site

  • Secondary purification using calmodulin affinity chromatography

  • Further purification using sucrose gradient ultracentrifugation and ion exchange column chromatography

This multi-step approach has been successfully employed to isolate intact Ycf4-containing complexes that retain their associated proteins, including COP2 and PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) . The purity and integrity of these complexes can be verified using immunoblotting with antibodies specific to the known components.

What imaging techniques are most effective for studying Ycf4 complex structure?

Transmission electron microscopy (TEM) combined with single particle analysis has proven to be an effective approach for visualizing the structure of purified Ycf4-containing complexes . This technique has revealed that the largest structures in purified Ycf4 preparations measure approximately 285 × 185 Å, representing several large oligomeric states .

The workflow for TEM analysis of Ycf4 complexes typically involves:

  • Sample preparation through negative staining or cryo-freezing

  • Image acquisition using high-resolution transmission electron microscopy

  • Digital image processing to enhance contrast and reduce noise

  • Single particle analysis to identify and classify different structural conformations

  • Three-dimensional reconstruction to generate structural models

These approaches have been instrumental in determining that Ycf4-containing complexes include newly synthesized PSI subunits assembled into an intermediate complex . The structural information obtained through electron microscopy provides critical insights into how Ycf4 facilitates the assembly of PSI components into functional photosystems.

Advanced techniques such as cryo-electron microscopy (cryo-EM) would likely provide even higher resolution structural information, potentially revealing the detailed molecular interactions between Ycf4 and its associated proteins within the assembly complex.

How does Ycf4 contribute to the assembly mechanism of Photosystem I?

Research into the functional role of Ycf4 indicates that it serves as a critical assembly factor for Photosystem I (PSI). The precise mechanism appears to involve Ycf4 acting as a scaffold or platform that brings together newly synthesized PSI subunits in the correct orientation for assembly . Pulse-chase protein labeling experiments have demonstrated that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized, suggesting that Ycf4 interacts with these components early in the assembly process .

The large Ycf4-containing complex (>1500 kD) incorporates several key PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as identified through mass spectrometry and immunoblotting techniques . This suggests that Ycf4 facilitates the organization of these subunits into a partially assembled PSI subcomplex that contains pigments, representing an intermediate step in the complete assembly of functional PSI complexes.

The essential nature of Ycf4 varies between species, with some photosynthetic organisms (like C. reinhardtii) showing an absolute requirement for Ycf4 in PSI accumulation, while others (like certain cyanobacteria) can assemble PSI at reduced levels in its absence . This variation suggests different evolutionary adaptations in the PSI assembly process, potentially involving alternative or redundant assembly pathways in some organisms.

Understanding the detailed molecular mechanisms by which Ycf4 facilitates PSI assembly requires further structural and functional studies, particularly focusing on the specific protein-protein interactions and the temporal sequence of assembly events.

What is known about the interaction between Ycf4 and COP2?

One of the most intriguing aspects of Ycf4 biology is its association with COP2, an opsin-related protein. Research has demonstrated that almost all Ycf4 and COP2 in wild-type cells copurify through sucrose gradient ultracentrifugation and subsequent ion exchange column chromatography . This intimate and exclusive association suggests a functional relationship between these two proteins in the context of PSI assembly.

COP2, as a retinal binding protein, may play a role in sensing light conditions or in the incorporation of pigments into the nascent PSI complex. The consistent co-purification of COP2 with Ycf4 indicates that their interaction is not transient but represents a stable structural or functional relationship within the assembly complex.

The exact nature of the Ycf4-COP2 interaction and its precise role in PSI assembly remains a subject for further investigation. Potential research approaches to elucidate this relationship could include:

  • Site-directed mutagenesis to identify critical interaction domains

  • Crosslinking studies to map the interaction interface

  • Functional assays in COP2-deficient mutants to determine the impact on PSI assembly

  • Structural studies using advanced imaging techniques to visualize the spatial arrangement of Ycf4 and COP2 within the complex

Such studies would provide valuable insights into the coordinated roles of these proteins in the PSI assembly process and potentially reveal novel mechanisms of photosystem biogenesis.

How does Ycf4 function differ between cyanobacteria and higher plants?

Comparative studies between cyanobacteria and higher plants have revealed significant differences in the functional importance of Ycf4. In higher plants and green algae like C. reinhardtii, Ycf4 is essential for PSI accumulation, with its absence resulting in a complete loss of PSI . In contrast, cyanobacterial mutants deficient in Ycf4 are still able to assemble PSI complexes, albeit at reduced levels .

This functional divergence suggests evolutionary adaptations in the PSI assembly process. Potential explanations include:

  • The development of alternative or additional assembly factors in cyanobacteria

  • Structural modifications to PSI subunits in cyanobacteria that enable some degree of self-assembly

  • Differences in thylakoid membrane organization and compartmentalization between prokaryotic cyanobacteria and eukaryotic chloroplasts

Understanding these differences provides insights into the evolutionary history of photosynthetic organisms and the increasing complexity of photosystem assembly mechanisms in higher plants. This comparative approach also helps identify conserved core functions versus derived adaptations in the PSI assembly process across the photosynthetic lineage.

What evolutionary insights can be gained from studying Ycf4 across different photosynthetic organisms?

Evolutionary analyses of Ycf4 can provide valuable insights into the development and adaptation of photosynthetic mechanisms across different lineages. The chloroplast genome, which contains the ycf4 gene, has been used extensively for phylogenetic analyses, helping to establish evolutionary relationships among plant species .

Studies on chloroplast genomes, such as those performed on Magnolia grandiflora, have demonstrated that comparing shared genes (including ycf genes) across multiple species using maximum parsimony (MP) and maximum likelihood (ML) methods can provide strong support for phylogenetic positions . While the search results don't specifically focus on Ycf4 evolutionary analyses, the approaches used for chloroplast genome comparisons would be applicable to understanding Ycf4 evolution.

Studying Ycf4 in basal angiosperms like Calycanthus floridus var. glaucus is particularly valuable, as these plants represent earlier evolutionary branches of flowering plants. Comparisons with more derived plant lineages can reveal how PSI assembly mechanisms have evolved and adapted throughout plant evolutionary history.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.