Recombinant Calycanthus floridus var. glaucus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

CP47 anchors chlorophyll molecules and facilitates energy transfer to the PSII reaction center. Its recombinant form is critical for:

  • Structural Studies: Resolving PSII complex architecture via cryo-EM or X-ray crystallography.

  • Mutagenesis Analysis: Investigating residues essential for chlorophyll binding (e.g., His-tagged regions) .

  • Biophysical Assays: Measuring light-harvesting efficiency and electron transport rates .

Production and Purification

The protein is synthesized in E. coli using codon-optimized psbB gene sequences . Key steps include:

  1. Cloning: Full-length psbB (UniProt ID: B0Z570) inserted into an expression vector.

  2. Expression: Induced via IPTG in E. coli BL21 strains.

  3. Purification: Affinity chromatography using Ni-NTA resins (His tag).

  4. Quality Control: Validated by SDS-PAGE and mass spectrometry .

Reconstitution Guidelines:

  • Solubility: Reconstitute in sterile water (0.1–1.0 mg/mL).

  • Stability: Add 50% glycerol for long-term storage at -80°C .

A. Comparative Genomics

Studies on the C. floridus var. glaucus chloroplast genome reveal psbB’s high conservation across angiosperms, with minimal sequence divergence in chlorophyll-binding domains .

B. Biotechnological Relevance

  • Photosynthesis Engineering: Used to enhance light absorption in synthetic chloroplast systems .

  • Phytoremediation: Modified CP47 variants improve PSII resilience in pollutant-stressed plants .

Challenges and Future Directions

  • Stability Issues: CP47 aggregates in vitro without detergents .

  • Functional Studies: Requires reconstitution with other PSII subunits (e.g., D1/D2 proteins) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on your purchase method and location. For precise delivery times, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein and what role does it play in photosynthesis?

CP47 (encoded by the psbB gene) functions as a core antenna protein in Photosystem II (PSII), playing a crucial role in light harvesting and excitation energy transfer to the PSII reaction center. The protein binds multiple chlorophyll molecules that capture photons and transfer excitation energy. This energy transfer ultimately drives the charge separation in the reaction center that initiates the electron transfer cascade of oxygenic photosynthesis .

Structurally, CP47 is an integral membrane protein that forms part of the PSII core complex. It contains transmembrane helices that anchor it within the thylakoid membrane and binds approximately 16 chlorophyll molecules. These chlorophylls have specific site energies and spatial arrangements that facilitate efficient excitation energy transfer to the reaction center .

What are the predicted chlorophyll binding sites in the CP47 protein of Calycanthus floridus var. glaucus?

The chlorophyll binding sites in CP47 proteins are typically identified through crystallographic studies combined with spectroscopic analyses. While specific data for Calycanthus floridus var. glaucus is not provided in the search results, we can infer based on similar proteins.

In CP47, chlorophyll binding typically involves coordination of the central magnesium ion of chlorophyll molecules by specific amino acid residues (often histidine) and hydrogen bonding networks that stabilize the chlorophyll within the protein scaffold. Studies of CP47 in cyanobacterial PSII have identified approximately 16 chlorophyll binding sites with varying site energies .

To predict specific binding sites in Calycanthus floridus var. glaucus CP47, researchers would typically:

  • Perform homology modeling based on crystallographic structures of CP47 from other organisms

  • Identify conserved histidine and other potential coordinating residues

  • Use molecular dynamics simulations to evaluate the stability of proposed chlorophyll binding sites

  • Validate predictions through site-directed mutagenesis and spectroscopic analysis

What expression systems are optimal for producing recombinant Calycanthus floridus var. glaucus CP47 protein?

Based on similar recombinant protein production approaches, E. coli expression systems are commonly used for CP47 protein production. The methodology typically involves:

  • Gene synthesis or cloning of the psbB gene from Calycanthus floridus var. glaucus

  • Insertion into an appropriate expression vector with a His-tag for purification

  • Transformation into an E. coli expression strain (e.g., BL21(DE3))

  • Induction of protein expression under optimized conditions

For membrane proteins like CP47, expression systems that include chaperones or specialized E. coli strains designed for membrane protein expression may improve yields and proper folding. Alternative expression systems such as insect cells or cell-free systems might be considered for challenging membrane proteins .

The typical workflow for recombinant CP47 expression would include:

StepProcedureCritical Parameters
1Gene optimization and vector designCodon optimization, appropriate promoter selection
2Transformation into expression hostSelection of appropriate strain (e.g., BL21(DE3))
3Small-scale expression testingTemperature, IPTG concentration, induction time optimization
4Large-scale culture and inductionOD600 at induction, growth media composition
5Cell harvesting and lysisLysis buffer composition with appropriate detergents

What purification strategies yield the highest purity and functionality for recombinant CP47 protein?

Purification of recombinant CP47 requires specialized approaches due to its membrane-associated nature. Based on similar protein purification methods, the following strategy would be recommended:

  • Affinity chromatography using the His-tag

    • Immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

    • Buffer containing appropriate detergents to maintain protein solubility

    • Imidazole gradient elution to minimize non-specific binding

  • Size exclusion chromatography

    • Further purification and assessment of protein aggregation state

    • Buffer optimization to maintain protein stability

  • Ion exchange chromatography (if needed)

    • Final polishing step to remove remaining contaminants

Throughout purification, it's critical to maintain an appropriate detergent environment to preserve the native-like structure of this membrane protein. The final purified protein should be stored in a buffer containing stabilizing agents such as glycerol (approximately 10-50%) at -20°C or -80°C to prevent freeze-thaw damage .

How can researchers verify the structural integrity of purified recombinant CP47 protein?

Verification of structural integrity for purified recombinant CP47 protein involves multiple analytical techniques:

  • SDS-PAGE and Western blotting

    • Confirms the correct molecular weight (approximately 47 kDa)

    • Western blotting with anti-His antibodies or specific anti-CP47 antibodies confirms identity

  • Circular dichroism (CD) spectroscopy

    • Evaluates secondary structure composition

    • Confirms proper protein folding

  • Absorption spectroscopy

    • Characteristic absorption spectra of bound chlorophylls in the visible region

    • Peaks at approximately 440-450 nm and 670-680 nm indicate properly bound chlorophylls

  • Fluorescence emission spectroscopy

    • Excitation at chlorophyll absorption maxima should yield characteristic emission peaks

    • The emission spectrum provides information about chlorophyll binding and energy transfer

  • Limited proteolysis

    • Properly folded proteins show characteristic proteolytic patterns

    • Compares proteolytic susceptibility to native CP47

These techniques collectively provide confidence in the structural integrity of the purified recombinant protein before proceeding to functional studies .

What spectroscopic methods are most suitable for studying chlorophyll excitation energies in recombinant CP47?

Several spectroscopic techniques are particularly valuable for studying chlorophyll excitation energies in recombinant CP47:

These methods would typically be combined with theoretical modeling approaches like quantum mechanics/molecular mechanics (QM/MM) calculations to interpret the spectroscopic data and assign specific site energies to individual chlorophylls .

How can researchers accurately determine the site energies of individual chlorophylls in CP47?

Determining site energies of individual chlorophylls in CP47 requires a multifaceted approach combining experimental spectroscopy with computational modeling:

  • Quantum mechanics/molecular mechanics (QM/MM) calculations

    • Full time-dependent density functional theory (TD-DFT) with range-separated functionals

    • Includes protein environment effects on chlorophyll electronic properties

    • Calculates excitation energies for each chlorophyll in its protein binding site

  • Site-directed mutagenesis

    • Mutation of specific chlorophyll-binding residues

    • Spectroscopic characterization of mutants to identify the contribution of individual chlorophylls

  • Pigment exchange experiments

    • Selective replacement of native chlorophylls with modified pigments

    • Shifts in spectroscopic properties reveal site-specific information

  • Temperature-dependent spectroscopy

    • Thermal population of excited states follows Boltzmann distribution

    • Analysis of temperature effects on spectra reveals energy gaps between states

Based on similar studies, a typical workflow would involve creating a structural model, calculating site energies computationally, and validating these through spectroscopic measurements and site-directed mutagenesis. For cyanobacterial CP47, chlorophylls designated as B3 and B1 have been identified as the most red-shifted (lowest energy) sites, contrary to previous assumptions in the literature .

What are the key experimental challenges in studying energy transfer within the CP47 protein complex?

Studying energy transfer within CP47 presents several significant experimental challenges:

  • Maintaining protein structural integrity

    • Membrane proteins are notoriously difficult to work with outside their native environment

    • Detergent selection critically affects protein stability and function

    • Development of nanodisc or liposome reconstitution methods may better mimic native environment

  • Spectral congestion

    • Multiple chlorophylls with overlapping spectra make it difficult to resolve individual contributions

    • Requires advanced spectroscopic techniques and mathematical deconvolution methods

  • Time resolution limitations

    • Energy transfer processes occur on femtosecond to picosecond timescales

    • Requires specialized ultrafast spectroscopy equipment

  • Sample heterogeneity

    • Recombinant protein preparations may contain misfolded or partially assembled complexes

    • Rigorous quality control and multiple purification steps are essential

  • Computational complexity

    • Modeling energy transfer requires quantum mechanical treatment of multiple chromophores

    • Balancing computational feasibility with accuracy remains challenging

To address these challenges, researchers typically employ a combination of advanced sample preparation techniques, multiple spectroscopic methods, and iterative computational modeling approaches .

How does the CP47 protein from Calycanthus floridus var. glaucus compare functionally to homologs from other plant species?

Comparing CP47 proteins across species provides valuable evolutionary insights. While specific comparative data for Calycanthus floridus var. glaucus CP47 is not provided in the search results, we can outline the methodological approach:

  • Sequence alignment and phylogenetic analysis

    • Alignment of CP47 sequences from various plant species

    • Construction of phylogenetic trees to establish evolutionary relationships

    • Identification of conserved and variable regions

  • Structural comparison

    • Homology modeling based on available crystal structures

    • Analysis of chlorophyll binding site conservation

    • Comparison of protein-protein interaction interfaces

  • Spectroscopic comparison

    • Absorption and fluorescence spectroscopy of CP47 from different species

    • Comparison of chlorophyll site energies and energy transfer properties

  • Functional comparison

    • Reconstitution of CP47 into minimal PSII complexes

    • Measurement of energy transfer efficiency to reaction centers

Calycanthus floridus, as a member of the ancient Calycanthaceae family within the order Laurales, represents an interesting evolutionary position among angiosperms. Comparing its CP47 with those from other plant lineages could provide insights into the evolution of photosynthetic machinery in flowering plants .

What structural adaptations in CP47 might reflect the ecological niche of Calycanthus floridus var. glaucus?

Calycanthus floridus is native to the Southeastern United States and has adapted to specific ecological conditions that might be reflected in its photosynthetic proteins, including CP47:

  • Light environment adaptations

    • Plants growing in understory conditions might show adaptations in chlorophyll site energies

    • Comparison of CP47 chlorophyll organization with sun-adapted species could reveal adaptations

  • Temperature sensitivity

    • Proteins from different climate zones often show adaptations in thermal stability

    • Thermal denaturation studies comparing CP47 from different ecological niches

  • Stress response elements

    • Identification of structural features that might contribute to stress resistance

    • Comparison with homologs from plants in different environmental conditions

To investigate these adaptations, researchers would typically:

  • Perform detailed spectroscopic analyses under varying conditions (temperature, pH, light intensity)

  • Compare sequence and structural features with CP47 from plants in different ecological niches

  • Conduct molecular dynamics simulations to identify regions with differential flexibility or stability

  • Correlate structural features with the known ecological conditions of Calycanthus floridus habitats

How can site-directed mutagenesis of CP47 from Calycanthus floridus var. glaucus inform our understanding of excitation energy transfer?

Site-directed mutagenesis of CP47 provides a powerful approach to understanding structure-function relationships in excitation energy transfer:

Expected outcomes from such studies include:

  • Identification of key residues controlling chlorophyll site energies

  • Understanding of energy transfer pathways within CP47

  • Insights into the mechanisms that direct energy flow toward the reaction center

These findings would contribute to fundamental understanding of photosynthetic light harvesting and could inform the design of artificial photosynthetic systems .

What are the potential applications of recombinant CP47 protein in artificial photosynthesis research?

Recombinant CP47 protein has several potential applications in artificial photosynthesis research:

  • Biohybrid light-harvesting systems

    • Integration of recombinant CP47 with synthetic light-harvesting materials

    • Development of protein-based solar energy conversion devices

    • Study of energy transfer between biological and synthetic components

  • Structure-function relationship studies

    • Systematic modification of CP47 to understand design principles

    • Engineering CP47 variants with altered spectral properties

    • Development of CP47-based spectral sensors

  • Educational and reference tools

    • Well-characterized recombinant CP47 as a standard for photosynthesis research

    • Development of teaching tools for photosynthesis education

    • Calibration standards for spectroscopic techniques

  • Protein engineering platforms

    • Template for designing novel light-harvesting proteins

    • Development of chimeric proteins combining features from different photosynthetic organisms

    • Evolution of enhanced light-harvesting capabilities

The methodological approach would involve:

  • Expression and purification of large quantities of recombinant protein

  • Characterization of spectral and energy transfer properties

  • Development of stable formulations for integration with synthetic materials

  • Testing in prototype artificial photosynthetic systems

How can computational modeling be integrated with experimental data to better understand CP47 function?

Integration of computational modeling with experimental data provides a comprehensive understanding of CP47 function:

  • Multiscale modeling approaches

    • Quantum mechanics (QM) calculations for chlorophyll electronic properties

    • Molecular mechanics (MM) for protein structure and dynamics

    • Combined QM/MM for environment effects on excitation energies

    • Course-grained models for larger-scale dynamics and interactions

  • Experimental data integration

    • Structural data (X-ray crystallography, cryo-EM) to establish 3D model

    • Spectroscopic data to validate calculated site energies

    • Mutagenesis results to refine understanding of specific interactions

    • Time-resolved data to benchmark energy transfer simulations

  • Iterative refinement workflow

    • Initial structural model based on homology or experimental structures

    • Calculation of spectroscopic properties

    • Comparison with experimental data

    • Refinement of model and parameters

    • Additional experiments to test model predictions

This integration has been successfully demonstrated in cyanobacterial CP47 studies where TD-DFT calculations with range-separated functionals accurately predicted chlorophyll site energies, identifying chlorophylls B3 and B1 as the most red-shifted, contradicting previous hypotheses .

What strategies can address low expression yields of recombinant CP47 protein?

Low expression yields are a common challenge with membrane proteins like CP47. Several strategies can address this issue:

  • Expression vector optimization

    • Test different promoters (T7, tac, araBAD)

    • Optimize ribosome binding site strength

    • Include translation enhancing elements (e.g., SUMO tag)

  • Host strain selection

    • C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Strains with additional tRNAs for rare codons (e.g., Rosetta)

    • Strains with reduced protease activity

  • Culture condition optimization

    • Lower induction temperature (16-25°C)

    • Reduced inducer concentration

    • Extended expression time (24-72 hours)

    • Alternative media formulations (e.g., terrific broth, auto-induction media)

  • Co-expression strategies

    • Molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Components of membrane protein insertion machinery

    • Chlorophyll biosynthesis enzymes for co-factor incorporation

  • Alternative expression systems

    • Cell-free protein synthesis systems

    • Insect cell expression (baculovirus system)

    • Yeast expression systems

Each approach requires systematic optimization with small-scale expression tests before scaling up to production levels. Protein quality should be assessed at each step to ensure properly folded protein is being produced .

How can researchers troubleshoot issues with chlorophyll binding in recombinant CP47 protein?

Proper chlorophyll binding is essential for CP47 function. Issues with chlorophyll incorporation can be addressed through several approaches:

  • Chlorophyll source optimization

    • Extraction of chlorophylls from plant material using optimized protocols

    • Use of synthetic chlorophyll analogs with enhanced stability

    • Co-expression with chlorophyll biosynthesis enzymes

  • Reconstitution protocol optimization

    • Systematic variation of chlorophyll:protein ratios

    • Testing different detergent types and concentrations

    • Optimization of temperature, pH, and ionic strength

    • Inclusion of lipids to mimic native membrane environment

  • Analytical troubleshooting

    • Absorption spectroscopy to monitor chlorophyll binding

    • Fluorescence to assess energy transfer capabilities

    • Circular dichroism to evaluate protein folding

    • Size exclusion chromatography to assess protein aggregation state

  • Stabilization strategies

    • Use of amphipols or nanodiscs instead of detergents

    • Addition of specific lipids known to stabilize photosynthetic complexes

    • Optimization of buffer components (glycerol, specific ions)

Success in chlorophyll binding can be monitored through the characteristic absorption peaks of protein-bound chlorophyll, which differ from those of free chlorophyll in solution, as well as through energy transfer measurements and structural analyses .

What quality control measures should be implemented when working with recombinant CP47 protein?

Rigorous quality control is essential when working with recombinant CP47 protein:

  • Purity assessment

    • SDS-PAGE with densitometry analysis (target >90% purity)

    • Western blot with specific antibodies

    • Mass spectrometry to confirm protein identity and detect modifications

  • Structural integrity evaluation

    • Circular dichroism to assess secondary structure

    • Fluorescence spectroscopy to confirm tertiary structure

    • Limited proteolysis to evaluate folding state

  • Functional characterization

    • Absorption spectroscopy to verify chlorophyll binding

    • Fluorescence emission spectroscopy to assess energy transfer

    • Time-resolved spectroscopy to measure energy transfer kinetics

  • Stability monitoring

    • Thermal stability assessment through differential scanning calorimetry

    • Long-term storage stability testing at different temperatures

    • Freeze-thaw stability testing with different cryoprotectants

  • Batch-to-batch consistency checks

    • Standardized analytical protocols for each production batch

    • Reference standards for comparative analysis

    • Statistical evaluation of batch variation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.