Recombinant Calycanthus floridus var. glaucus Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The psbD protein is an essential subunit of Photosystem II (PSII), a multisubunit complex in chloroplasts that catalyzes light-driven water oxidation. In Calycanthus floridus var. glaucus (Eastern sweetshrub), the recombinant psbD protein (UniProt ID: Q7YJX7) retains the functional characteristics of its native counterpart, including participation in the PSII reaction center (RC) and stabilization of chlorophyll-binding sites .

Production and Purification

Expression System:

  • Host: Escherichia coli .

  • Tag: N-terminal His-tag for immobilized metal affinity chromatography (IMAC) .

Purification Metrics:

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose
Storage Temperature–20°C/–80°C (lyophilized powder)
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Functional Insights from Research

Role in PSII Assembly and Repair:

  • The D2 protein partners with D1 to form the PSII RC, facilitating charge separation and plastoquinone binding .

  • Photodamage to D2 necessitates repair mechanisms involving proteases like FtsH2, which degrade damaged subunits .

Comparative Analysis of PSII Core Proteins:

FeatureD2 Protein (psbD)D1 Protein (psbA)
FunctionStabilizes RC; binds plastoquinoneCatalyzes water oxidation; binds Mn4CaO5 cluster
Photodamage SusceptibilityModerateHigh
Repair MechanismDegraded by FtsH proteasesRapidly replaced via de novo synthesis

Research Applications

  • Structural Studies: Used in cryo-EM analyses to resolve PSII dimer architecture .

  • Photosynthesis Mutants: Serves as a control in studies of PSII-deficient mutants (e.g., pvsl1 in Phaseolus vulgaris) .

  • Biogenesis Pathways: Helps elucidate assembly intermediates involving Psb27 and Ycf48 chaperones .

Recent Findings in PSII Biology

  • Protease Dependency: PvFtsH2 in common bean is critical for degrading photodamaged D1/D2 proteins, with mutants showing lethal phenotypes under high light .

  • Assembly Intermediates: Psb27 stabilizes PSII dimers during repair, as shown in Thermosynechococcus vulcanus .

  • Conservation: Homologs like Arabidopsis FtsH2 share functional overlap with psbD-interacting proteases .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
psbD
Target Protein Sequence
MTIALGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O. This process generates O2 and a proton gradient, which is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 is crucial for assembling a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II D2 protein (psbD) and what is its role in photosynthesis?

The Photosystem II D2 protein (psbD) is one of the core components of the photosynthetic reaction center in Photosystem II (PSII). Together with the D1 protein, it forms the heterodimeric reaction center that constitutes the functional core of PSII, which is a multi-subunit light-driven oxidoreductase driving photosynthetic electron transport using electrons extracted from water .

The D1/D2 heterodimer binds the chlorophyll (Chl) and pheophytin (Pheo) molecules that are responsible for the light-induced primary charge separation step within PSII . The primary electron donor, P680, comprises four special chlorophyll molecules bound to both D1 and D2, while the primary electron acceptor, pheophytin, is specifically bound to D1 . Upon light absorption, electron transfer occurs from P680 to pheophytin, resulting in the formation of the P680+Pheo- radical pair, which is the initial step in the photosynthetic electron transport chain .

How does the psbD gene organization compare between Calycanthus floridus and other photosynthetic organisms?

The psbD gene, which encodes the D2 protein of Photosystem II, shows evolutionary conservation but with notable organizational differences across various photosynthetic organisms. In higher plants like Calycanthus floridus var. glaucus, the psbD gene is located in the chloroplast genome .

Interestingly, studies have discovered the presence of psbD genes not only in photosynthetic organisms but also in phages that infect marine cyanobacteria . In some marine phages, such as S-PM2 and S-RSM88, the psbA and psbD genes (encoding D1 and D2 proteins, respectively) are arranged in proximity, separated by only two ORFs, suggesting they might function as a conserved module .

Phylogenetic analysis of psbD genes from various sources including phages, Synechococcus, and Prochlorococcus shows distinct clustering patterns. There is strong support (78%) for a clade containing Synechococcus and phages, and even stronger support (100%) for a subgroup containing all phages . This suggests horizontal gene transfer events and evolutionary relationships between these genes across different organisms.

How do assembly dynamics differ between D1 and D2 modules during PSII biogenesis?

During the biogenesis of Photosystem II, the assembly of D1 and D2 modules shows distinct characteristics and dynamics. Research using strains of the cyanobacterium Synechocystis sp. PCC 6803 has provided detailed insights into these differences .

The isolated D1 module (D1 mod) consists of D1/PsbI/Ycf48 with some Ycf39 and Phb3, while the D2 module (D2 mod) contains D2/cytochrome b559 with co-purifying proteins including PsbY, Phb1, Phb3, FtsH2/FtsH3, CyanoP, and Slr1470 . A significant finding is that stably bound chlorophyll was detected in the D1 module but not in the D2 module, suggesting that the formation of the complete RCII (Reaction Center II) complex is critical for the stable binding of most chlorophylls and both pheophytins .

The RCII assembly complexes contain the PSII subunits D1, D2, PsbI, PsbE, and PsbF along with assembly factors including rubredoxin A and Ycf48, as well as PsbN, Slr1470, and Slr0575 proteins, all of which have plant homologs . Additionally, prohibitins/stomatins (Phbs) of unknown function and FtsH protease subunits are found in these complexes. The assembled RCII complexes are capable of light-induced primary charge separation and bind chlorophylls, pheophytins, beta-carotenes, and heme .

What methods can be used to study the primary charge separation function of recombinant D2 protein?

The primary charge separation function of recombinant D2 protein, particularly when assembled with D1 to form the RCII complex, can be studied using spectroscopic techniques that measure light-induced electron transfer events. One effective approach is to measure reversible light-induced absorption difference spectra in specific wavelength ranges.

Based on research methodologies, the following protocol can be implemented:

  • Prepare RCII assembly complexes containing D1 and D2 proteins.

  • Measure the reversible light-induced absorption difference spectra in the range of 650–710 nm under two conditions:
    a. In the presence of an electron acceptor (e.g., silicomolybdate) to detect the accumulation of oxidized primary donor (P680+)
    b. In the presence of a reducing agent (e.g., sodium dithionite) to detect reduction of the primary electron acceptor (pheophytin)

These measurements should produce results similar to those obtained with isolated plant PSII reaction center complexes. The observation of characteristic absorption changes would confirm that the RCII assembly complexes can perform primary photochemical reactions and therefore contain the complete set of pigments required for these reactions .

For more precise quantification of photoactive P680 or pheophytin, further purification of specific RCII complexes from crude preparations may be necessary to assess their individual spectral properties and pigment composition .

What are the implications of psbD gene conservation in phages for evolutionary biology research?

The discovery of psbD genes in phages that infect marine cyanobacteria has significant implications for evolutionary biology research, particularly regarding horizontal gene transfer and the evolution of photosynthesis.

The psbD gene, along with psbA, has been found in the genomes of marine cyanophages, suggesting that these phages may play a role in transferring photosynthetic genes between different cyanobacterial hosts . Remarkably, some phages like S-PM2 and S-RSM88 show identical organization of the psbAD region, with the genes being separated by only two ORFs . The DNA sequences in this region show extreme conservation, including the presence of identical group I introns in the psbA genes .

This conservation, despite considerable geographical separation of isolation sites, suggests that these genes might occur as part of a conserved module that is mobile across different environments . Phylogenetic analysis of psbD genes from various sources shows distinct clustering patterns that provide insights into the evolutionary relationships between these genes in different organisms.

For evolutionary biology research, these findings suggest:

  • Horizontal gene transfer may play a significant role in the evolution of photosynthetic systems

  • Phages may act as vectors for the transfer of photosynthetic genes between different hosts

  • The conservation of these genes in phages suggests they might confer some selective advantage

  • The study of psbD genes in diverse organisms can provide insights into the evolutionary history of photosynthesis

What are the optimal conditions for storage and handling of recombinant psbD protein?

The proper storage and handling of recombinant Calycanthus floridus var. glaucus psbD protein is critical for maintaining its structural integrity and functional activity. Based on the available information, the following conditions are recommended:

ParameterRecommended ConditionNotes
Storage temperature-20°C to -80°CFor extended storage, -80°C is preferable
Working aliquots4°CStore for up to one week only
Storage bufferTris-based buffer with 50% glycerolOptimized for protein stability
Alternative bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0For lyophilized preparations
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended
ReconstitutionDeionized sterile waterTo a concentration of 0.1-1.0 mg/mL
Glycerol for reconstituted protein5-50% (final concentration)50% is the default recommendation

For recombinant protein supplied as lyophilized powder, it should be briefly centrifuged prior to opening to bring the contents to the bottom . After reconstitution, the protein should be aliquoted to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity .

How can researchers assess the functional integrity of recombinant psbD protein in experimental systems?

Assessing the functional integrity of recombinant psbD protein is essential for ensuring reliable experimental results. Since the D2 protein functions in conjunction with D1 to form the PSII reaction center, functional assays typically involve evaluating the activity of the assembled complex rather than the isolated D2 protein.

A comprehensive approach for assessing functional integrity includes:

  • Spectroscopic Analysis: Measure absorption spectra to confirm proper folding and pigment binding. The D1/D2 heterodimer should bind chlorophylls, pheophytins, beta-carotenes, and heme .

  • Light-Induced Charge Separation: Assess the ability to perform primary photochemistry by measuring reversible light-induced absorption difference spectra in the range of 650–710 nm:

    • In the presence of an electron acceptor (e.g., silicomolybdate) to detect oxidized P680+

    • In the presence of sodium dithionite to detect reduced pheophytin

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with known interaction partners (e.g., D1, PsbE, PsbF)

    • Blue native gel electrophoresis to assess complex formation

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Limited proteolysis to assess proper folding and accessibility of cleavage sites

  • Functional Reconstitution:

    • Assembly with other PSII components to form functional RCII complexes

    • Evaluation of electron transfer activities in the reconstituted system

Results from these assays should be compared to positive controls, such as native PSII preparations or well-characterized recombinant PSII complexes, to determine the functional integrity of the recombinant psbD protein.

What experimental protocols can be used to study psbD-protein interactions within the PSII complex?

Studying protein-protein interactions involving the psbD-encoded D2 protein within the PSII complex requires specialized experimental approaches. The following protocols are recommended for investigating these interactions:

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS):

    • Express His-tagged recombinant D2 protein in an appropriate expression system

    • Perform affinity purification using Ni-NTA or similar matrices

    • Analyze co-purifying proteins by mass spectrometry to identify interaction partners

    • This approach has successfully identified that D2 modules contain D2/cytochrome b559 with co-purifying proteins including PsbY, Phb1, Phb3, FtsH2/FtsH3, CyanoP, and Slr1470

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies specific to the D2 protein or use anti-tag antibodies for recombinant tagged D2

    • Perform immunoprecipitation from thylakoid membrane preparations

    • Analyze co-precipitated proteins by western blotting or mass spectrometry

  • Yeast Two-Hybrid (Y2H) or Split-Ubiquitin Systems:

    • Construct fusion proteins between D2 and appropriate Y2H domains

    • Screen for interactions with other PSII components

    • Note: Membrane proteins like D2 may require specialized Y2H systems such as the membrane-based split-ubiquitin system

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of D2 and potential interaction partners with split fluorescent protein fragments

    • Express in appropriate host cells

    • Analyze reconstitution of fluorescence as indicator of protein-protein interaction

  • Cross-linking Coupled with Mass Spectrometry:

    • Treat PSII preparations with chemical cross-linkers

    • Digest and analyze by mass spectrometry to identify cross-linked peptides

    • Determine interaction interfaces between D2 and other proteins

For studying the assembly of D1/D2 complexes specifically, researchers can use strains arrested at early stages of PSII biogenesis, expressing affinity-tagged PSII subunits to isolate RCII complexes and their precursor modules .

How can researchers distinguish between native and recombinant psbD protein function in experimental systems?

Distinguishing between native and recombinant psbD protein function requires careful experimental design and analytical approaches. The following methodological strategies can help researchers make this distinction:

  • Tagged Protein Tracking:

    • Use recombinant D2 protein with specific tags (e.g., His-tag) that are not present in the native protein

    • Perform Western blot analysis using tag-specific antibodies to specifically detect recombinant protein

    • Compare migration patterns of tagged recombinant versus untagged native D2 in gel electrophoresis

  • Genetic Complementation Analysis:

    • Use psbD knockout/mutant organisms that lack functional native D2 protein

    • Introduce recombinant D2 and assess restoration of PSII function

    • Compare photosynthetic parameters between complemented strains and wild type

  • Spectroscopic Fingerprinting:

    • Compare absorption, fluorescence, and circular dichroism spectra between native PSII complexes and those containing recombinant D2

    • Look for subtle differences in spectral properties that might indicate structural variations

  • Functional Activity Comparison:

    • Measure light-induced charge separation kinetics in both systems

    • Compare electron transfer rates and quantum yields

    • Analyze oxygen evolution capacity if assessing complete PSII complexes

  • Structural Analysis:

    • Use techniques like limited proteolysis to compare structural accessibility and folding

    • Analyze thermal stability profiles to detect potential differences

    • If possible, compare high-resolution structural data

These approaches should be complemented with appropriate controls, including:

  • Wild-type systems containing only native protein

  • Systems expressing recombinant protein that is identical in sequence to the native form (no mutations or modifications beyond tagging)

  • Mixed systems where both native and recombinant proteins are present in known ratios

What analytical challenges exist in studying chlorophyll binding to recombinant D2 protein?

Studying chlorophyll binding to recombinant D2 protein presents several analytical challenges that researchers must address to obtain reliable results:

  • Limited Chlorophyll Stability in D2 Module:

    • Research has shown that stably bound chlorophyll is detected in D1 modules but not in D2 modules, suggesting that formation of the complete RCII complex is important for stable binding of chlorophylls

    • This indicates that studying chlorophyll binding to isolated D2 may be inherently difficult due to instability of the protein-pigment interaction

  • Recombinant Expression Challenges:

    • Expression of membrane proteins like D2 in recombinant systems often results in improper folding

    • Co-expression with chlorophyll biosynthesis machinery may be necessary for proper pigment incorporation

    • Bacterial expression systems lack the chlorophyll biosynthetic pathway, requiring supplementation or alternative expression hosts

  • Pigment Analysis Considerations:

    • Chlorophyll extraction protocols may cause pigment degradation or modification

    • Quantification requires careful calibration and standardization

    • Distinguishing specifically bound versus non-specifically associated chlorophylls is challenging

  • Spectroscopic Interference:

    • Presence of free chlorophyll or other pigments can interfere with spectroscopic measurements

    • Overlapping absorption and fluorescence spectra of different chlorophyll species complicate analysis

    • Protein autofluorescence may interfere with some measurements

  • Methodological Approaches:

    • HPLC analysis can separate and quantify different pigment species but requires careful extraction

    • Fluorescence lifetime measurements can help distinguish bound from free chlorophylls

    • Resonance Raman spectroscopy can provide information about the environment of bound chlorophylls

To address these challenges, researchers may need to:

  • Work with assembled RCII complexes rather than isolated D2 protein

  • Consider using native-like membrane environments for recombinant D2 expression

  • Develop specialized pigment extraction and analysis protocols

  • Use multiple complementary analytical techniques to cross-validate findings

How do researchers interpret evolutionary relationships between psbD genes from different sources?

Interpreting evolutionary relationships between psbD genes from different sources requires sophisticated phylogenetic analysis and consideration of multiple factors. Researchers typically follow these methodological approaches:

  • Sequence Alignment and Phylogenetic Tree Construction:

    • Multiple sequence alignment of psbD genes from diverse organisms and phages

    • Construction of phylogenetic trees using methods such as maximum likelihood, Bayesian inference, or neighbor-joining

    • Evaluation of clade support values to assess the reliability of groupings

  • Clade Analysis and Interpretation:

    • Studies have identified a major clade with strong support (100%) containing all phage, Synechococcus, and Prochlorococcus psbD genes

    • Good support (78%) has been found for a clade containing Synechococcus and phages

    • Strong support (100%) exists for a subgroup containing all phages

    • Analysis of these relationships provides insights into the evolutionary history and potential horizontal gene transfer events

  • Comparative Genomic Context Analysis:

    • Examination of the genetic organization around psbD in different organisms

    • In some phages like S-PM2 and S-RSM88, psbA and psbD are separated by only two ORFs, suggesting they may function as a conserved module

    • Presence of identical group I introns in psbA genes of these phages further supports their close evolutionary relationship

  • Geographic Distribution Considerations:

    • Analysis of geographical isolation sites of organisms carrying similar psbD genes

    • Conservation of gene sequences despite geographical separation suggests mobile genetic elements or strong selective pressure

  • Molecular Dating and Rate Analysis:

    • Estimation of divergence times based on molecular clock approaches

    • Analysis of substitution rates to identify potential selection pressures

A comprehensive interpretation would consider:

  • The possibility of horizontal gene transfer between phages and hosts

  • Selective pressure maintaining gene function across diverse organisms

  • Co-evolution of psbD with other photosynthetic genes

  • Potential adaptive advantages conferred by particular psbD variants

  • Ecological factors influencing gene distribution and conservation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.