Recombinant Calycanthus floridus var. glaucus Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

The psbA gene encodes the D1 protein, which forms the reaction center of PSII and facilitates water-splitting during oxygenic photosynthesis. Key features include:

PropertyDetails
UniProt IDQ7YJY8
Gene SynonymsPhotosystem II protein D1, 32 kDa thylakoid membrane protein
Protein Length344 amino acids (full-length)
Molecular Weight~32 kDa
TagN-terminal His-tag for purification
Structural RoleTransmembrane protein coordinating chlorophyll, pheophytin, and plastoquinone
Source OrganismCalycanthus floridus var. glaucus (Eastern sweetshrub)
Recombinant ExpressionE. coli

The amino acid sequence (MTAILERRES...NAHNFPLDLA) is conserved across plant species, with critical residues for manganese cluster assembly and plastoquinone binding .

Expression System

  • Host: E. coli (optimized for high-yield soluble expression) .

  • Vector: Custom plasmid with T7/lac promoter for induced expression .

Purification Protocol

  1. Affinity Chromatography: Nickel-NTA resin leveraging the His-tag .

  2. Buffer Composition: Tris/PBS-based buffer with 6% trehalose (pH 8.0) for stability .

  3. Purity: >90% confirmed by SDS-PAGE .

Photosynthesis Studies

  • Mechanistic Insights: Used to investigate electron transfer dynamics and PSII repair mechanisms under photoinhibitory conditions .

  • Herbicide Resistance: Target site for triazine and urea herbicides; mutagenesis studies identify resistance-conferring residues .

Biotechnological Applications

  • Bioengineering: Template for designing synthetic photosynthetic systems .

  • Environmental Monitoring: Biosensor for detecting photosynthetic inhibitors in ecosystems .

Genomic and Evolutionary Context

Chloroplast genome analyses reveal psbA as a highly conserved gene, though its genomic positioning varies due to recombination hotspots and inverted repeat (IR) expansions . For example:

  • In Trachelium caeruleum, psbA duplicates correlate with IR boundary shifts .

  • Magnolia grandiflora exhibits IR-SSC junction alterations affecting psbA flanking regions .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is assigned during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Calycanthus floridus var. glaucus (Eastern sweetshrub) (Calycanthus fertilis var. ferax)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H₂O, producing O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein (psbA) and what is its function in Calycanthus floridus var. glaucus?

The psbA gene encodes the Photosystem II protein D1 (also known as the PSII D1 protein or Photosystem II Q(B) protein), which serves as a critical component of the photosynthetic apparatus. This protein plays an essential role in the electron transport chain of Photosystem II, specifically binding to plastoquinone B (Q(B)) and facilitating electron transfer during the light-dependent reactions of photosynthesis. In Calycanthus floridus var. glaucus (Eastern sweetshrub), this protein functions similarly to other plant species but may exhibit unique adaptations related to the plant's native habitat in rich mountain woodlands and streambanks .

How does Calycanthus floridus var. glaucus psbA differ from psbA proteins in other plant species?

Comparative analysis of psbA proteins across plant species reveals both conserved regions essential for photosynthetic function and variable regions that may reflect evolutionary adaptations to specific ecological niches. The Calycanthus floridus var. glaucus psbA protein maintains the highly conserved functional domains necessary for electron transport and plastoquinone binding.

Key methodological approaches for such comparisons include:

  • Multiple sequence alignment using CLUSTAL or MUSCLE algorithms

  • Phylogenetic analysis to determine evolutionary relationships

  • Selection pressure analysis to identify positively selected residues

  • Structure prediction and modeling to assess functional implications of sequence variations

Specific differences may be related to the plant's adaptation to its native habitats in the southeastern United States, where it grows in rich mountain woods, hillsides, and streambanks . Calycanthus floridus var. glaucus's status as a threatened species in Kentucky (State Rank S2) suggests it may have unique adaptations reflected in its photosynthetic apparatus .

What are the optimal conditions for reconstitution and storage of recombinant Calycanthus floridus var. glaucus psbA protein?

For optimal reconstitution and storage of the recombinant psbA protein, researchers should follow these evidence-based protocols:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as standard)

  • Aliquot for long-term storage to minimize freeze-thaw cycles

Storage Conditions:

  • Long-term storage: -20°C to -80°C (lyophilized form has a shelf life of approximately 12 months)

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

The stability of the protein is affected by multiple factors including buffer composition, pH, and storage temperature. Researchers should validate protein activity after reconstitution using functional assays relevant to their experimental design.

What expression systems are most effective for producing recombinant Calycanthus floridus var. glaucus photosystem proteins?

Based on current research methodologies, two primary expression systems have demonstrated effectiveness for recombinant production of Calycanthus floridus var. glaucus photosystem proteins:

Expression SystemTarget ProteinAdvantagesLimitationsYield
E. colipsbA (Photosystem Q(B) protein)High yield, well-established protocols, cost-effectivePotential improper folding of membrane proteins, lack of post-translational modificationsVariable, but typically >90% purity via His-tag purification
BaculoviruspsaB (Photosystem I P700 chlorophyll a apoprotein A2)Better for complex proteins, eukaryotic post-translational modificationsHigher cost, longer production timeTypically >85% purity (SDS-PAGE)

For membrane proteins like psbA, researchers often encounter challenges related to protein solubility and proper folding. Methodological approaches to address these challenges include:

  • Optimization of induction temperature (typically lower temperatures of 16-20°C)

  • Addition of solubility-enhancing tags (His, MBP, SUMO)

  • Co-expression with molecular chaperones

  • Use of specialized E. coli strains designed for membrane protein expression

The choice of expression system should be guided by the specific research objectives, required protein modifications, and downstream applications .

How can researchers verify the structural integrity and functionality of purified psbA protein?

Verifying both structural integrity and functionality of purified psbA protein requires a multi-faceted approach:

Structural Verification Methods:

  • SDS-PAGE: Confirms molecular weight and initial purity assessment (>90% purity expected for quality preparations)

  • Western Blot: Validates protein identity using anti-His antibodies or specific anti-psbA antibodies

  • Circular Dichroism (CD): Assesses secondary structure composition

  • Size Exclusion Chromatography (SEC): Evaluates aggregation state and homogeneity

  • Mass Spectrometry: Confirms exact mass and potential post-translational modifications

Functional Verification Methods:

  • Plastoquinone Binding Assays: Measures binding affinity for plastoquinone using isothermal titration calorimetry or fluorescence quenching

  • Electron Transport Assays: Assesses electron transfer capability using artificial electron donors/acceptors

  • Reconstitution into Liposomes: Evaluates function in a membrane environment

  • Chlorophyll Fluorescence: Measures photochemical efficiency when incorporated into membrane systems

When implementing these methods, researchers should include appropriate positive controls (e.g., well-characterized psbA from model organisms) and negative controls to validate their findings.

How can Calycanthus floridus var. glaucus psbA be used in photosystem assembly and repair studies?

The recombinant psbA protein from Calycanthus floridus var. glaucus offers a valuable tool for investigating photosystem assembly and repair mechanisms, particularly given the unique ecological niche of this threatened plant species. Advanced research applications include:

In vitro Reconstitution Studies:

  • Step-wise assembly of minimal PSII complexes using purified components

  • Investigation of cofactor integration during assembly

  • Analysis of protein-protein interactions within the PSII complex

PSII Repair Cycle Investigations:

  • Examination of the D1 protein turnover rate under various stress conditions

  • Identification of chaperones and auxiliary factors involved in psbA/D1 integration

  • Comparative analysis with model organisms to identify unique repair mechanisms

These studies typically employ methodologies such as:

  • Blue-native PAGE for complex assembly analysis

  • Pulse-chase experiments to track protein turnover

  • Cryo-electron microscopy for structural analysis of assembly intermediates

  • Fluorescence recovery after photobleaching (FRAP) for in vivo dynamics

The unique characteristics of Calycanthus floridus var. glaucus, which thrives in part shade to shade conditions, may reveal adaptations in its photosystem repair mechanisms that contribute to its survival in lower light environments .

What methods are recommended for investigating psbA protein interactions with other photosynthetic components?

Investigating protein-protein interactions involving psbA requires sophisticated methodological approaches:

In vitro Interaction Methods:

  • Pull-down assays using His-tagged psbA as bait

  • Surface Plasmon Resonance (SPR) for real-time binding kinetics

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Microscale Thermophoresis (MST) for interactions in solution

In vivo Interaction Methods:

  • Bimolecular Fluorescence Complementation (BiFC)

  • Förster Resonance Energy Transfer (FRET)

  • Co-immunoprecipitation with subsequent mass spectrometry

  • Chemical cross-linking followed by mass spectrometry (XL-MS)

Data Analysis Approaches:

  • Network analysis to map the interactome

  • Molecular dynamics simulations to model interaction interfaces

  • Machine learning algorithms to predict interaction partners

When studying psbA interactions, researchers should consider the membrane environment's influence on protein behavior. Reconstitution into nanodiscs or liposomes often provides a more native-like environment for membrane protein interaction studies than detergent-solubilized systems.

How can site-directed mutagenesis of Calycanthus floridus var. glaucus psbA contribute to understanding photosystem function?

Site-directed mutagenesis of the psbA protein represents a powerful approach for structure-function relationship studies in photosynthesis research. Key methodological considerations include:

Mutagenesis Strategy Design:

  • Selection of conserved residues based on multiple sequence alignments

  • Targeting of specific functional domains (e.g., QB binding pocket, chlorophyll binding sites)

  • Creation of alanine scanning libraries to systematically map functional regions

  • Introduction of residues found in extremophiles to enhance protein stability

Functional Impact Assessment:

  • Oxygen evolution measurements to quantify photosynthetic efficiency

  • Electron transport rate determination

  • Herbicide binding assays (many herbicides target the QB binding site)

  • Structural stability analysis under various stress conditions

Recommended Analytical Framework:

Mutation TypeExpected OutcomesAnalytical MethodsControls
Conservative (similar amino acids)Subtle functional changesHigh-resolution kinetic analysisWild-type protein
Non-conservativeSignificant functional alterationsMultiple functional assaysBoth wild-type and dead mutants
Deletion or truncationDomain function lossDomain-specific functional testsComplementation studies

This approach has successfully identified critical residues involved in electron transport, plastoquinone binding, and interactions with other PSII subunits in model organisms, and can be applied to understand unique adaptations in Calycanthus floridus var. glaucus.

What structural features distinguish the QB binding pocket in Calycanthus floridus var. glaucus psbA?

The QB binding pocket of psbA (D1 protein) represents one of the most critical functional domains in Photosystem II. Based on structural analysis and homology modeling with known PSII structures, the Calycanthus floridus var. glaucus psbA protein contains several key features:

Key Structural Elements:

  • Transmembrane helices that form the hydrophobic binding pocket

  • Conserved histidine residues that coordinate with a non-heme iron

  • Serine and threonine residues that form hydrogen bonds with plastoquinone

  • Phenylalanine residues that provide hydrophobic interactions with the plastoquinone tail

Researchers typically investigate these structural features using:

  • Homology modeling based on high-resolution crystal structures

  • Molecular dynamics simulations to assess binding pocket dynamics

  • Docking studies with plastoquinone and various herbicides

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for electron transfer energetics

The unique ecological niche of Calycanthus floridus var. glaucus in rich mountain woods with part shade to shade conditions may have led to subtle adaptations in its QB binding pocket to optimize photosynthesis under these specific light conditions .

How does the structural stability of Calycanthus floridus var. glaucus psbA compare to that of model plant species?

Comparative stability analysis of psbA from Calycanthus floridus var. glaucus versus model plant species reveals important insights into evolutionary adaptations:

Methodological Approaches for Stability Assessment:

  • Thermal shift assays to determine melting temperatures

  • Limited proteolysis to identify flexible or exposed regions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

  • Circular dichroism spectroscopy under varying conditions (temperature, pH, denaturants)

Expected Stability Determinants:

  • Amino acid composition (particularly proline content in loop regions)

  • Hydrogen bonding networks

  • Salt bridge distributions

  • Membrane-protein interactions

Given that Calycanthus floridus var. glaucus is a threatened species in Kentucky with specific habitat requirements , its psbA protein may exhibit structural adaptations that contribute to its survival in its specific ecological niche. Researchers should consider these ecological factors when interpreting stability data.

What spectroscopic methods are most informative for analyzing the functional state of recombinant psbA protein?

Multiple spectroscopic techniques provide complementary information about the functional state of recombinant psbA protein:

Spectroscopic MethodInformation ObtainedTechnical RequirementsLimitations
UV-Visible AbsorptionChlorophyll binding, basic structural integrityStandard spectrophotometerLimited structural detail
Circular Dichroism (CD)Secondary structure composition, thermal stabilityCD spectropolarimeterRequires relatively high protein concentrations
Fluorescence SpectroscopyChlorophyll environment, energy transfer efficiencyFluorimeter with appropriate excitation sourcesComplex interpretation in multi-chromophore systems
EPR SpectroscopyRedox-active cofactors, radical formationEPR spectrometer, low temperature equipmentTechnically demanding, specialized equipment
FTIR SpectroscopyProtein secondary structure, cofactor bindingFTIR spectrometer with appropriate sample cellsSample preparation challenges

For comprehensive functional analysis, researchers should combine multiple spectroscopic approaches with biochemical assays. This multi-faceted approach allows correlation between structural features and functional outcomes, providing deeper insights into the protein's role in photosynthesis.

How has the psbA gene evolved in Calycanthus floridus var. glaucus compared to other plant lineages?

Evolutionary analysis of the psbA gene in Calycanthus floridus var. glaucus provides insights into adaptation and conservation patterns:

Methodological Framework for Evolutionary Analysis:

  • Phylogenetic tree construction using maximum likelihood or Bayesian methods

  • Calculation of synonymous (dS) and non-synonymous (dN) substitution rates

  • Tests for selection pressure (dN/dS ratio analysis)

  • Identification of conserved domains versus variable regions

Calycanthus floridus belongs to the family Calycanthaceae, an early-diverging lineage among flowering plants. This evolutionary position makes its psbA gene particularly valuable for understanding the evolution of photosynthetic machinery across plant lineages .

Researchers studying psbA evolution should pay particular attention to:

  • Regions associated with herbicide binding (high selection pressure)

  • Residues involved in QB binding (functionally constrained)

  • Transmembrane domains (structurally constrained)

  • Surface-exposed loops (potentially more variable)

This evolutionary perspective provides context for understanding functional adaptations in the photosynthetic apparatus of Calycanthus floridus var. glaucus, which has adapted to specific ecological niches in rich mountain woods and streambanks .

What can comparative analysis of psbA and psaB proteins from Calycanthus floridus var. glaucus reveal about photosystem co-evolution?

Comparative analysis of psbA (Photosystem II) and psaB (Photosystem I) proteins from Calycanthus floridus var. glaucus offers unique insights into the co-evolution of these critical photosynthetic complexes:

Analytical Approaches:

  • Synchronized phylogenetic analysis of both proteins

  • Correlation analysis of evolutionary rates

  • Identification of co-evolving residue networks

  • Mapping of interaction interfaces between the photosystems

Expected Research Outcomes:

  • Identification of coordinated adaptations between photosystems

  • Understanding of electron transfer optimization between PSII and PSI

  • Insights into regulatory mechanisms balancing photosystem activities

  • Detection of lineage-specific adaptations in Calycanthus floridus var. glaucus

The psaB protein (Photosystem I P700 chlorophyll a apoprotein A2) and psbA (Photosystem II protein D1) represent core components of their respective photosystems, and their coordinated function is essential for efficient photosynthesis. Their comparative analysis can provide valuable information about how Calycanthus floridus var. glaucus has optimized its photosynthetic apparatus for its specific ecological niche.

How do environmental adaptations of Calycanthus floridus var. glaucus correlate with psbA protein characteristics?

The threatened status and specific habitat requirements of Calycanthus floridus var. glaucus suggest potential correlations between its environmental adaptations and psbA protein characteristics:

Environmental Factors and Potential psbA Adaptations:

Environmental FactorHabitat CharacteristicPotential psbA AdaptationResearch Methodology
Light ConditionsPart shade to shade preference Modified electron transport kineticsChlorophyll fluorescence analysis under varying light intensities
Seasonal ChangesDeciduous with yellow fall color Seasonal regulation of photosystem stoichiometrySeasonal sampling and protein quantification
Soil ConditionsRich mountain woods, hillsides Adaptations to specific nutrient availabilityGrowth under controlled nutrient conditions
Water AvailabilityPreference for streambanks Modifications in water oxidation complexDrought response experiments

Research investigating these correlations should employ:

  • Comparative genomics across Calycanthus populations from different habitats

  • Ecophysiological measurements in natural settings

  • Controlled environment studies manipulating key variables

  • Functional characterization of psbA variants

Understanding these environment-protein correlations contributes to both basic photosynthesis research and potential conservation strategies for this threatened species, particularly in light of changing environmental conditions that may impact its specialized habitat requirements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.