Recombinant Camptotheca acuminata 3-hydroxy-3-methylglutaryl-coenzyme A reductase

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Camptotheca acuminata (Happy tree)
Target Protein Sequence
MDVRRRSINSIHQIPSVGGTAPPMLKPKQPTKVDAVDLPDSPKASDALPLPLYITNGVFF TLFFTVVYYLLVRWREKIRNSTPLHVVTLSEIAAIFTFVASFIYLLGFFGIGLVQPFTSR SSHDDVWGVDDDEDVDEIVLKEDTRTVPCAAAPVDCPLPPIKPKVVDPVPISPPSSEEDE EIIKSVVEGTTPSYALESKLGDSHRAAAIRREALQRMTKKSLAGLPLDGFDYDSILGQCC EMPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFACGGATSVLLRDA MTRAPVVRFGSAKRAADLKFFLENPLNFETLAAVFNSSSRFGKLQNIKCAIAGKNLYMRY SCSTGDAMGMNMISKGVQNVLDFLQDDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVV CEAVIKEEVVKKVLKTNVASLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQD PAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK EAPGSNARLLATIVAGSVLAGELSLMSAIAAGQLVNSHMKYNRSNKDVTKASS
Uniprot No.

Target Background

Function

This recombinant Camptotheca acuminata 3-hydroxy-3-methylglutaryl-coenzyme A reductase catalyzes mevalonate synthesis, a precursor for all isoprenoid compounds in plants.

Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological role of 3-hydroxy-3-methylglutaryl-coenzyme A reductase in Camptotheca acuminata?

HMGR from Camptotheca acuminata is a critical enzyme that catalyzes the conversion of HMG-CoA to mevalonic acid in the mevalonate (MVA) pathway. This enzyme supplies mevalonate for the synthesis of the terpenoid component of camptothecin (CPT), an anti-cancer monoterpenoid indole alkaloid, as well as for the formation of many other primary and secondary metabolites. HMGR serves as a rate-limiting enzyme in isoprenoid biosynthesis, controlling the flux through the MVA pathway that leads to diverse terpenoid compounds .

What is the structural composition of Camptotheca acuminata HMGR protein?

The Camptotheca acuminata HMGR protein features several conserved functional domains that are critical to its enzymatic activity. The full-length protein contains:

  • Two HMG-CoA binding motifs

  • Two NADPH-binding motifs

  • A complete amino acid sequence of 593 residues

  • A catalytic domain that shares homology with HMGR proteins from other plant species

The protein sequence (UniProt P48021) includes characteristic membrane-spanning domains at the N-terminus and a cytosolic catalytic domain at the C-terminus, consistent with the typical structure of plant HMGR enzymes .

How is the hmg1 gene expressed in Camptotheca acuminata tissues?

Expression analysis reveals that hmg1 transcripts in Camptotheca acuminata show a highly specific developmental and tissue-specific pattern:

  • Transcripts are detected only in young seedlings

  • Notably absent in vegetative organs of older plants

  • When the hmg1 promoter was studied in transgenic tobacco using translational fusions with the β-glucuronidase (GUS) reporter gene, expression was localized to:

    • Epidermis of young leaves and stems (particularly in glandular trichomes)

    • Cortical tissues in the root elongation zone

    • Light staining in the cortex of mature roots

    • Sepals, petals, pistils, and stamens of developing flowers

    • Most intense staining in the ovary wall, ovules, stigmas, and pollen

This distinctive expression pattern suggests a developmental role for HMGR in Camptotheca acuminata, likely related to specific metabolic needs during early growth and reproductive development .

What are the optimal conditions for expressing recombinant Camptotheca acuminata HMGR in E. coli systems?

Based on experimental data from similar plant HMGR expression systems:

  • Expression vector selection:

    • pET expression systems (particularly pET28a) show good results for plant HMGR expression

    • Include a His-tag for efficient purification

  • Expression conditions:

    • Host strain: E. coli BL21(DE3) shows good results for plant HMGR expression

    • Induction: 0.5-1.0 mM IPTG when OD600 reaches 0.6-0.8

    • Post-induction cultivation: Low-temperature expression (10-15°C) for 48-72 hours significantly increases soluble protein yield compared to standard 37°C expression

    • Shaking speed: 110 rpm appears optimal for protein folding

  • Protein extraction and purification:

    • Lysis in Tris-based buffer containing glycerol and reducing agents

    • Ni-IDA resin-based affinity chromatography works effectively for His-tagged HMGR

    • The truncated catalytic domain (lacking the membrane-spanning regions) yields higher soluble protein compared to full-length expression

Importantly, both supernatant and inclusion bodies contain active protein, but enzymatic activity of the soluble fraction (supernatant) is typically orders of magnitude higher than that of refolded inclusion bodies .

How can HMGR activity be reliably measured in experimental settings?

HMGR activity can be measured using several approaches:

  • HPLC/MS method:

    • Reaction mixture containing purified HMGR, HMG-CoA, and NADPH

    • Incubation at 37°C for 30-60 minutes

    • Reaction termination by adding perchloric acid or methanol

    • HPLC separation followed by mass spectrometry detection

    • The mevalonate product shows a characteristic retention time (approximately 2.2 minutes) and SCIEX TripleTOF 5600+ m/z value of 131.0710

  • Spectrophotometric assay:

    • Continuous monitoring of NADPH oxidation at 340 nm

    • Reaction mixture containing HMG-CoA, NADPH, and enzyme in appropriate buffer

    • Calculate activity based on the decrease in absorbance over time

  • Radioisotope-based assay:

    • Using [14C]-HMG-CoA as substrate

    • Measure conversion to [14C]-mevalonate

    • Separate products by thin-layer chromatography

For valid measurements, enzymatic reactions should be conducted within the linear range, and appropriate controls (enzyme-free, substrate-free) should be included to account for background reactions .

What approaches can be used to study the regulation of Camptotheca acuminata HMGR expression?

Several complementary approaches can be employed:

  • Promoter analysis:

    • Cloning of the hmg1 promoter region (various lengths: -1678, -1107, -165 bp)

    • Creation of translational fusions with reporter genes (e.g., GUS)

    • Transformation into model plants (e.g., tobacco)

    • Histochemical analysis to visualize spatial and temporal expression patterns

  • Stress response analysis:

    • Treatment of plant tissues with various elicitors and stressors:

      • Methyl jasmonate (MJ)

      • Abscisic acid (ABA)

      • Salicylic acid (SA)

      • Ethephon (Eth)

      • Cold stress

      • Dark treatment

      • Wounding

    • Quantification of transcript levels using qRT-PCR

    • Correlation of expression changes with metabolite production

  • Transgenic approaches:

    • Overexpression of hmg1 in model plants

    • Analysis of downstream effects on the MVA pathway and related metabolites

    • Measurement of terpenoid compounds (e.g., ABA, GA, carotenes, lycopene)

These methods have revealed that the hmg1 promoter is responsive to various environmental and developmental cues, with as little as 165 bp of the promoter being sufficient to confer both developmental regulation and stress responses .

How does the wound-induction and methyl jasmonate suppression mechanism of Camptotheca acuminata HMGR differ from other plant HMGRs?

The wound-response mechanism of Camptotheca acuminata HMGR presents a distinctive regulatory pattern compared to other plant HMGRs:

Plant SpeciesWound ResponseMJ ResponseKey Regulatory Elements
Camptotheca acuminata15-20 fold induction over 72hComplete suppression165-bp promoter fragment sufficient
Solanum lycopersicum (tomato)Moderate inductionVariable (organ-dependent)Requires larger promoter regions
Arabidopsis thalianaVaried (isoform-dependent)Generally inducedContains JA-responsive elements
Catharanthus roseusStrong inductionGenerally inducedContains wound-responsive elements

The unusual suppression of wound-induced hmg1 expression by methyl jasmonate in Camptotheca acuminata contrasts with most other plant systems, where jasmonate typically induces HMGR expression. This unique regulatory pattern may reflect specialized evolutionary adaptations related to camptothecin biosynthesis.

The suppression mechanism likely involves:

  • Jasmonate-responsive elements within the 165-bp promoter fragment

  • Possible interaction with specific transcription factors

  • Cross-talk with other signaling pathways

  • Potential feedback inhibition mechanisms

This distinctive regulatory mechanism may be exploited for manipulating secondary metabolite production in both native and heterologous expression systems .

What are the implications of Camptotheca acuminata HMGR in metabolic engineering of terpenoid biosynthesis?

Camptotheca acuminata HMGR presents several unique opportunities for metabolic engineering:

  • Rate-limiting control point:

    • As the first committed enzyme in the MVA pathway, HMGR overexpression can increase flux toward terpenoid production

    • Studies with other plant HMGRs show 3-10 fold increases in downstream metabolites when overexpressed

  • Promoter engineering applications:

    • The compact (165 bp) promoter with strong regulatory responses enables the creation of sophisticated expression cassettes

    • Potential for designing stress-inducible production systems

    • Wound-inducible but jasmonate-repressible characteristics allow for novel regulatory circuits

  • Cross-talk with other pathways:

    • Overexpression of HMGR not only affects MVA pathway genes but also impacts MEP pathway genes

    • Enhancement of diverse terpenoid end products including:

      • Abscisic acid (ABA)

      • Gibberellic acid (GA)

      • Carotenes and lycopene

  • Species-specific considerations:

    • The unique regulatory properties of Camptotheca acuminata HMGR may provide advantages for particular metabolic engineering applications

    • Potential for enhancing production of high-value secondary metabolites beyond camptothecin

These findings suggest that Camptotheca acuminata HMGR can serve as a valuable tool for enhancing production of diverse terpenoid compounds with applications in pharmaceuticals, flavors, fragrances, and biofuels .

How does the catalytic mechanism of Camptotheca acuminata HMGR compare with HMGRs from other organisms in terms of kinetic parameters?

Comparative analysis of HMGR catalytic properties across species reveals important differences:

SourceKm for HMG-CoA (μM)Km for NADPH (μM)kcat (s-1)pH OptimumTemperature Optimum (°C)
Camptotheca acuminata35-4540-502-37.0-7.530-37
Human (catalytic domain)15-2530-353-47.5-8.037
Saccharomyces cerevisiae10-1525-302.5-3.56.5-7.030
Arabidopsis thaliana30-4035-452-37.0-7.530-35

Note: Values presented are approximated ranges based on available data from similar plant HMGRs; exact parameters for Camptotheca acuminata HMGR should be experimentally determined

The catalytic mechanism of plant HMGRs, including Camptotheca acuminata HMGR, involves:

  • Binding of NADPH to form a binary enzyme-cofactor complex

  • Binding of HMG-CoA to form a ternary complex

  • Hydride transfer from NADPH to the thioester carbonyl of HMG-CoA

  • Formation of a hemithioacetal intermediate

  • Cleavage of the C-S bond to release CoA

  • Second hydride transfer to form mevalonate

  • Release of products (mevalonate and NADP+)

Structural differences in the catalytic domain and substrate-binding regions between plant and animal HMGRs make plant HMGRs insensitive to statins (common inhibitors of human HMGR). This key difference has implications for inhibitor design and development of regulators specific to plant terpenoid metabolism .

What strategies can overcome the challenges in expressing and purifying full-length Camptotheca acuminata HMGR?

The expression and purification of full-length plant HMGRs present several challenges due to their membrane-spanning domains. Research-based strategies to address these challenges include:

  • Optimized expression systems:

    • Eukaryotic expression hosts (yeast, insect cells) that better accommodate membrane proteins

    • Specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Truncation strategies:

    • Expression of only the catalytic domain (amino acids ~150-593)

    • Design of constructs with partial membrane domains that retain regulatory properties

    • Addition of solubility-enhancing tags (MBP, SUMO, TrxA)

  • Membrane protein purification approaches:

    • Detergent screening (mild non-ionic detergents like DDM, LMNG)

    • Nanodisc or liposome reconstitution

    • Styrene maleic acid lipid particles (SMALPs) for native membrane environment preservation

  • Advanced purification techniques:

    • Two-step affinity chromatography (e.g., His-tag followed by StrepII-tag)

    • Size exclusion chromatography to remove aggregates

    • On-column refolding protocols for inclusion body recovery

For researchers primarily interested in catalytic function, the truncated version (lacking membrane domains) provides a pragmatic approach that yields significantly higher amounts of active enzyme suitable for most biochemical characterizations .

How might the unique wound-response and jasmonate-suppression mechanism of Camptotheca acuminata HMGR be exploited for controlled production of camptothecin?

The distinctive regulatory pattern of Camptotheca acuminata HMGR offers novel approaches for controlled metabolite production:

  • Inducible production systems:

    • Development of mechanical wounding systems to trigger HMGR expression and subsequent camptothecin production

    • Design of transgenic production platforms with wound-inducible promoters

    • Creation of bioreactor systems that incorporate controlled physical stress

  • Jasmonate-mediated suppression for production timing:

    • Sequential application of wounding followed by timed jasmonate treatment to create production pulses

    • Engineering of jasmonate-insensitive variants to maintain high production

    • Development of molecular switches based on the interplay between wound and jasmonate signaling

  • Metabolic engineering approaches:

    • Fine-tuning of the wound-response elements in the promoter region

    • Creation of synthetic promoters with enhanced wound response but diminished jasmonate sensitivity

    • Co-expression of wound-responsive transcription factors with modified jasmonate signaling components

  • Field application considerations:

    • Timing of harvest post-wounding to maximize camptothecin yield

    • Development of cultivation practices that incorporate controlled stress induction

    • Potential for implementing automated wounding systems in agricultural settings

This regulatory mechanism provides a promising framework for creating production systems where metabolite synthesis can be precisely timed and controlled, potentially improving both yield and economic feasibility of camptothecin production .

What are the current gaps in understanding the transcriptional regulation network controlling Camptotheca acuminata HMGR expression?

Several critical knowledge gaps remain in understanding the complete regulatory network of Camptotheca acuminata HMGR:

  • Transcription factor identification:

    • The specific transcription factors that bind to the 165-bp promoter region remain largely uncharacterized

    • The transcriptional activators mediating wound response have not been fully identified

    • The jasmonate-responsive repressors that suppress wound activation are unknown

  • Signaling cascade interactions:

    • The precise mechanism by which jasmonate suppresses wound-induced expression remains unclear

    • Cross-talk between jasmonate signaling and other hormone pathways (e.g., salicylic acid, ethylene) requires further investigation

    • The role of calcium signaling and MAP kinase cascades in the wound response is not fully elucidated

  • Developmental regulation:

    • Factors controlling the seedling-specific expression pattern are unknown

    • The mechanism suppressing expression in mature vegetative tissues requires clarification

    • The interplay between developmental and stress-responsive elements needs further characterization

  • Tissue-specific regulatory elements:

    • The regulatory elements directing expression to specific tissues (trichomes, root cortex, reproductive organs) remain to be precisely mapped

    • Cell-type specific transcription factors involved in this regulation are unknown

Future research directions should include chromatin immunoprecipitation (ChIP) studies to identify transcription factor binding, yeast one-hybrid screens to discover interacting proteins, and CRISPR-based promoter editing to precisely define functional regulatory elements .

What are the optimal storage conditions for maintaining the activity of purified recombinant Camptotheca acuminata HMGR?

Based on experimental data from similar plant HMGRs, the following storage conditions are recommended for maintaining optimal enzyme activity:

  • Short-term storage (up to 1 week):

    • Store at 4°C in a buffer containing:

      • 50 mM Tris-HCl (pH 7.5)

      • 150 mM NaCl

      • 10% glycerol

      • 1 mM DTT or 2 mM β-mercaptoethanol

    • Avoid repeated freezing and thawing

  • Medium-term storage (up to 1 month):

    • Store at -20°C in a buffer containing:

      • 50 mM Tris-HCl (pH 7.5)

      • 150 mM NaCl

      • 50% glycerol

      • 1 mM DTT or 2 mM β-mercaptoethanol

    • Prepare multiple small-volume aliquots to avoid freeze-thaw cycles

  • Long-term storage (months to years):

    • Store at -80°C in a buffer containing:

      • 50 mM Tris-HCl (pH 7.5)

      • 150 mM NaCl

      • 50% glycerol

      • 1 mM DTT or 2 mM β-mercaptoethanol

      • Consider adding 0.1 mg/ml BSA as a stabilizer

    • Flash-freeze in liquid nitrogen before transferring to -80°C

  • Stability enhancers:

    • Addition of protease inhibitors (PMSF, leupeptin, pepstatin)

    • Inclusion of 0.1-0.5 mM EDTA to chelate heavy metals

    • Some researchers report improved stability with 0.01% Triton X-100 or similar mild detergent

Activity should be monitored periodically, as some loss may occur even under optimal storage conditions. For critical experiments, freshly purified enzyme is always preferred .

How can researchers effectively design experiments to investigate the cross-talk between MVA and MEP pathways involving Camptotheca acuminata HMGR?

Designing experiments to investigate pathway cross-talk requires multiple complementary approaches:

  • Transgenic manipulation strategies:

    • Overexpression of Camptotheca acuminata HMGR in model plants (Arabidopsis, tobacco) or homologous systems

    • RNAi or CRISPR-mediated knockdown/knockout of HMGR

    • Creation of reporter lines with MVA and MEP pathway gene promoters driving different fluorescent proteins

  • Metabolic labeling approaches:

    • Application of 13C-labeled glucose, pyruvate, or acetate

    • Tracing isotopomer distribution in downstream metabolites

    • Use of pathway-specific inhibitors (mevinolin for MVA pathway, fosmidomycin for MEP pathway)

  • Transcript analysis design:

    • Time-course experiments following HMGR manipulation

    • qRT-PCR analysis of both pathways' key genes:

      • MVA pathway: AACT, HMGS, HMGR, MVK, PMK, MVD

      • MEP pathway: DXS, DXR, MCT, CMK, MDS, HDS, HDR, IDI

    • RNA-seq for genome-wide effects

  • Metabolite profiling:

    • Targeted analysis of pathway intermediates

    • Comprehensive analysis of end products:

      • Sterols (MVA pathway)

      • Carotenoids and chlorophylls (MEP pathway)

      • Abscisic acid, gibberellins (derived from both pathways)

    • Spatial distribution using imaging mass spectrometry

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of HMGR with potential interacting proteins

    • Yeast two-hybrid or split-ubiquitin assays

    • Bimolecular fluorescence complementation (BiFC) in planta

These multi-faceted approaches can provide comprehensive insights into the regulatory networks connecting these two compartmentalized but interdependent pathways of isoprenoid biosynthesis .

What analytical methods are most appropriate for quantifying changes in terpenoid profiles resulting from Camptotheca acuminata HMGR manipulation?

Multiple analytical platforms are required for comprehensive terpenoid profiling:

  • Chromatographic methods:

    • HPLC-UV/Vis for carotenoids and other colored terpenoids

    • HPLC-ELSD (Evaporative Light Scattering Detector) for non-chromophoric terpenoids

    • GC-MS for volatile and semi-volatile terpenoids after appropriate derivatization

    • UPLC-MS/MS for sensitive detection of low-abundance terpenoids

  • Mass spectrometry approaches:

    • Triple quadrupole MS/MS for targeted quantification

    • High-resolution MS (Q-TOF, Orbitrap) for untargeted profiling and structural elucidation

    • Multiple Reaction Monitoring (MRM) for sensitive quantification of specific terpenoids

    • MALDI-imaging MS for spatial distribution analysis

  • Sample preparation considerations:

    • Liquid-liquid extraction optimized for different terpenoid classes

    • Solid-phase extraction for cleanup and concentration

    • Derivatization strategies (trimethylsilylation for GC-MS)

    • Enzyme inhibitors during extraction to prevent degradation

  • Quantification approaches:

    • Stable isotope-labeled internal standards

    • Standard addition methods for complex matrices

    • External calibration with authentic standards

    • Relative quantification for untargeted profiling

  • Specialized techniques for specific compounds:

    • For camptothecin: HPLC with fluorescence detection (Ex: 370 nm, Em: 435 nm)

    • For phytohormones (ABA, GA): UPLC-MS/MS with appropriate internal standards

    • For sterols: GC-MS after derivatization

    • For carotenoids: HPLC with photodiode array detection

Statistical analysis of the resulting data should include multivariate approaches (PCA, PLS-DA) to identify patterns of coregulated terpenoids and correlation analysis to establish relationships between pathway gene expression and metabolite levels .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.