Recombinant Campylobacter concisus Glycerol-3-phosphate acyltransferase (plsY)

What is the biochemical function of Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter concisus?

Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter concisus functions as an essential enzyme in phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid, which is a critical intermediate in membrane phospholipid synthesis. The enzyme belongs to the acyltransferase family and is characterized as an acyl-phosphate--glycerol-3-phosphate acyltransferase with the EC designation 2.3.1.n3 . This initial acylation step is crucial for the subsequent synthesis of phospholipids that constitute bacterial cell membranes, making plsY essential for bacterial viability and growth.

What is the structural composition of recombinant C. concisus plsY?

The recombinant C. concisus plsY protein consists of 203 amino acids with the following sequence: MQNLILYAVSYLLGSIPSGLILAKIFGHVDIKKEGSKSIGATNVLRVLKQTNPKLAKKLA ILTVVCDVLKGVLPLIVASFLGASQSVLWTMAVLSVAGHCFSIFLGFQGGKGVATGAGVL AFFLPVEIIIALVVWFLVGKFLKISSLASLCALIALIASSFIIHPELDEIYTHAPILIIA FLVVYKHIPNIVRLLSGKEQKVV . The protein is derived from Campylobacter concisus strain 13826 and is registered in the UniProt database with the accession number A7ZBZ7. The ordered locus name is Ccon26_04020, and its ORF name is CCC13826_0982. As a membrane-associated enzyme, plsY contains hydrophobic regions essential for membrane integration, allowing it to access its substrate glycerol-3-phosphate at the membrane interface.

How does plsY differ from other acyltransferases in Campylobacter species?

The plsY acyltransferase differs from other Campylobacter acyltransferases like PglA in substrate specificity and cellular function. While PglA is involved in N-linked glycosylation pathways that are essential for pathogenicity and survival through the transfer of N-acetylgalactosamine (GalNAc) to undecaprenyl-diphospho-N,N′-diacetylbacillosamine (UndPP-diNAcBac) , plsY specifically participates in phospholipid biosynthesis. The structural differences between these enzymes reflect their distinct functions: plsY is optimized for interaction with glycerol-3-phosphate and acyl-phosphate, while glycosyltransferases like PglA contain specific binding motifs for sugar donors and acceptors. Additionally, unlike the glycosyltransferases that typically adopt a GT-B fold with double-Rossmann domains, plsY likely has a structure more adapted to its role in phospholipid synthesis at the membrane interface.

How does membrane association affect the enzymatic activity of C. concisus plsY?

As a membrane-associated enzyme, plsY's activity is intricately linked to its interaction with the bacterial membrane. The amino acid sequence of C. concisus plsY contains hydrophobic segments that likely facilitate membrane association: "MQNLILYAVSYLLGSIPSGLILAKIFGHVDIKKE..." . The membrane association of plsY is critical for:

• Proper orientation of the active site to access both water-soluble (glycerol-3-phosphate) and membrane-embedded (acyl-phosphate) substrates

• Enhanced local concentration of substrates at the membrane interface

• Potential allosteric regulation through membrane lipid interactions

Studies on related membrane-associated enzymes suggest that the membrane composition can significantly affect enzymatic activity. For example, analysis of GT-B fold enzymes like PglA reveals that "evolution of membrane-interacting structural elements in the acceptor-binding domain allows the development of specificity for a membrane embedded substrate without necessitating changes to the catalytic site" . This principle likely applies to plsY as well, where specific membrane-interacting domains would position the enzyme optimally for catalysis.

What is the role of plsY in C. concisus pathogenicity?

While direct evidence linking plsY to C. concisus pathogenicity is not explicitly provided in the search results, several inferences can be made based on the role of phospholipid biosynthesis in bacterial viability and the known pathogenic mechanisms of C. concisus.

C. concisus is an oral bacterium that has been implicated in gastric diseases . As a key enzyme in phospholipid biosynthesis, plsY is essential for bacterial membrane formation and integrity. Disruption of plsY function would likely impair bacterial growth and virulence. Recent studies have shown that C. concisus can induce:

• Production of IL-8 by gastric epithelial cells

• Increased caspase 3/7 activities, indicating induction of apoptosis

• Actin rearrangement in host cells

• Upregulation of 30 genes in gastric epithelial cells, including CYP1A1

These pathogenic effects require viable bacteria with intact membranes, indirectly implicating phospholipid biosynthesis, and by extension plsY, in pathogenicity. Furthermore, the ability of bacteria to adapt their membrane composition in response to environmental conditions (which depends on phospholipid biosynthesis enzymes like plsY) may contribute to survival in the host and expression of virulence factors.

What are the optimal storage and handling conditions for recombinant C. concisus plsY?

The optimal storage and handling conditions for recombinant C. concisus plsY are critical for maintaining its structural integrity and enzymatic activity. Based on the product information, the following guidelines should be followed:

The high glycerol content (50%) in the storage buffer serves multiple purposes: it prevents ice crystal formation that could damage protein structure, reduces protein aggregation, and helps maintain enzymatic activity. When designing experiments, it's advisable to consider the potential effects of the storage buffer components on your assay system and perform appropriate controls to account for buffer effects.

What assay methods are most effective for measuring C. concisus plsY enzymatic activity?

Effective assay methods for measuring C. concisus plsY enzymatic activity should be designed to detect the formation of lysophosphatidic acid from glycerol-3-phosphate and acyl-phosphate. Several complementary approaches can be employed:

• Radiometric Assays:

  • Using [14C]-labeled glycerol-3-phosphate or [14C]-labeled acyl donors

  • Quantification of labeled lysophosphatidic acid by thin-layer chromatography and scintillation counting

  • Provides high sensitivity but requires radioisotope handling facilities

• Spectrophotometric Coupled Assays:

  • Coupling plsY activity to the consumption or production of NAD(P)H

  • Monitoring absorbance changes at 340 nm

  • Allows continuous monitoring but may be subject to interference

• HPLC or LC-MS Methods:

  • Direct quantification of reaction products

  • Can provide detailed information on product specificity

  • Requires specialized equipment but offers high specificity

When implementing these assays, several considerations should be addressed:

• The hydrophobic nature of the substrates may require detergent inclusion

• Optimization of pH and ionic strength is critical for maximum activity

• Temperature optimization (typically 30-37°C for Campylobacter enzymes)

• Inclusion of appropriate controls for non-enzymatic reactions

The choice of assay should be guided by the specific research question, available equipment, and desired throughput.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of plsY?

Site-directed mutagenesis represents a powerful approach to investigate the catalytic mechanism of plsY by systematically altering specific amino acid residues and assessing the impact on enzyme activity. Based on approaches used with related enzymes, the following methodology is recommended:

• Target Residue Selection:

  • Conserved residues identified through sequence alignment with homologous acyltransferases

  • Residues predicted to be in the active site based on structural modeling

  • Charged residues (Asp, Glu, Lys, Arg) that might participate in catalysis

  • Hydrophobic residues that likely form the binding pocket for the acyl chain

• Mutation Design Strategy:

  • Conservative substitutions (e.g., Asp→Glu) to probe the importance of side chain length

  • Charge reversal mutations (e.g., Asp→Lys) to investigate electrostatic interactions

  • Alanine scanning to identify essential side chains

• Activity Analysis of Mutants:

  • Determination of kinetic parameters (Km, kcat) for each mutant

  • Analysis of substrate specificity changes

  • Thermal stability assessment using differential scanning fluorimetry

This approach has been successfully applied to related enzymes. For example, in Campylobacter concisus PglA, mutagenesis studies revealed that "E113, conserved solely among PglA enzymes, forms a hydrogen bond with the GalNAc C6′′-OH" . Similar studies with plsY would help identify catalytic residues and distinguish between roles in substrate binding versus transition state stabilization.

How can recombinant plsY be utilized in structural biology investigations?

Recombinant C. concisus plsY can be utilized in various structural biology investigations to elucidate its three-dimensional structure and mechanism of action. Based on approaches used with related enzymes, the following methodologies are recommended:

• X-ray Crystallography:

  • Requires high-purity protein preparations (>95% homogeneity)

  • Optimization of crystallization conditions (buffers, precipitants, additives)

  • Co-crystallization with substrates or substrate analogs to capture enzyme-substrate complexes

  • Resolution of 2.0 Å or better for detailed mechanistic insights

• Cryo-Electron Microscopy (Cryo-EM):

  • Particularly valuable for membrane-associated proteins like plsY

  • May reveal dynamic conformational states

  • Can be combined with lipid nanodiscs to study the enzyme in a membrane-like environment

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • For studying dynamics and ligand interactions

  • Requires isotope-labeled protein (13C, 15N)

  • Most effective for specific domains rather than the full protein

Structural information obtained through these methods would provide invaluable insights into:

• The spatial arrangement of catalytic residues

• Substrate binding pocket architecture

• Conformational changes during catalysis

• Membrane interaction interfaces

By analogy, the structural determination of C. concisus PglA at 1.8 Å resolution led to identification of "distinguishing characteristics that set PglA apart within the GT4 enzyme family" . Similar high-resolution structural studies of plsY would advance our understanding of acyltransferase mechanisms and substrate specificity.

What approaches can be used to investigate plsY as a potential antimicrobial target?

Given the essential role of plsY in phospholipid biosynthesis and bacterial membrane formation, it represents a potential target for antimicrobial development. Several research approaches can be employed to investigate its potential as a drug target:

• Target Validation:

  • Genetic approaches: Conditional knockdowns to demonstrate essentiality

  • Chemical genetics: Use of known inhibitors of related enzymes

  • Comparative genomics: Assessment of conservation across pathogenic Campylobacter species

• High-Throughput Screening (HTS):

  • Development of a robust, scalable enzyme activity assay

  • Screening of compound libraries against recombinant plsY

  • Counter-screening against human homologs to identify selective inhibitors

• Structure-Based Drug Design:

  • Using crystal structures to identify binding pockets

  • In silico docking to predict compounds with high binding affinity

  • Fragment-based approaches to develop high-affinity ligands

• Evaluation of Inhibitors:

  • Determination of inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Assessment of antibacterial activity against C. concisus and related pathogens

  • In vitro cytotoxicity studies to evaluate safety profiles

The development of plsY inhibitors would be particularly valuable given the emerging evidence of C. concisus involvement in gastric diseases. Studies have shown that C. concisus can induce IL-8 production, increase caspase 3/7 activities, and cause actin rearrangement in gastric epithelial cells . Targeting plsY could potentially disrupt these pathogenic processes by inhibiting bacterial growth and viability.

How might C. concisus plsY substrate specificity differ from plsY in other bacterial species?

The substrate specificity of C. concisus plsY may differ from that of other bacterial species due to variations in amino acid sequences that influence substrate binding and catalysis. While specific comparative studies of plsY across species are not provided in the search results, insights can be drawn from studies of other enzymes.

For example, research on glycosyltransferases has shown that subtle differences in binding site residues can significantly alter substrate preferences. In PglA, "Pro281 in a substrate binding loop directs configurational preference for GalNAc over GlcNAc," while this proline "is replaced by a conformationally flexible glycine, even in distant homologs, which favor substrates with the same stereochemistry at C4" .

Similar variations likely exist among plsY enzymes from different bacterial species, potentially affecting:

• Acyl Chain Preference:

  • Length specificity (short, medium, or long-chain fatty acids)

  • Saturation preference (saturated vs. unsaturated acyl chains)

  • Branched chain accommodation

• Glycerol-3-phosphate Binding:

  • Affinity differences affecting Km values

  • Binding orientation influencing regioselectivity

• Catalytic Efficiency:

  • Variations in kcat due to differences in transition state stabilization

  • pH optima reflective of the bacterial niche

Comparative analysis of plsY sequences from various bacterial species, combined with homology modeling and enzyme kinetic studies, would provide insights into these species-specific differences. Such information could be valuable for developing species-selective inhibitors and understanding the adaptation of phospholipid biosynthesis to different bacterial lifestyles.