Recombinant Campylobacter concisus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Ccon26_05280; CCC13826_1549; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Campylobacter concisus (strain 13826)
Target Names
mscL
Target Protein Sequence
MSFISEFKEFAMRGNVIDMAVGVVIGGAFGKIVSSLVGDIIMPVVGVVTGGVNFTDLKLT LKEAAEGAPAVTINYGSFIQTMVDFLIIAFCIFCVIKALNTLKNKLPKEEEAAPAEPEIP ADIALLTEIRDLLKK
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Mechanosensitive channels in Campylobacter species?

Mechanosensitive channels in bacteria like Campylobacter typically form homopentameric structures with each subunit containing two transmembrane regions. These channels open in response to stretch forces in the lipid bilayer through a bilayer mechanism involving hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile. The channels function as biological pressure valves that prevent cell lysis during osmotic shock by releasing solutes from the cytoplasm when membrane tension increases .

How does MscL expression change under different growth conditions in Campylobacter?

MscL protein is typically upregulated during stationary phase and during osmotic shock to prevent cell lysis . For C. concisus specifically, which is a fastidious, hydrogen-requiring bacterium, optimal expression conditions would need to consider its microaerobic or anaerobic growth requirements. Studies examining biofilm formation in C. concisus suggest that environmental conditions significantly affect protein expression patterns, potentially including mechanosensitive channels that might contribute to survival under stress conditions .

What are the challenges in recombinant expression of Campylobacter membrane proteins?

The main challenges include:

  • Maintaining proper folding and insertion into membranes

  • Addressing the fastidious growth requirements of C. concisus (microaerobic/anaerobic conditions with hydrogen)

  • Selecting appropriate expression systems (bacterial, yeast, baculovirus, or mammalian cells)

  • Purification while maintaining protein functionality

  • Ensuring protein stability during expression and purification processes

Which expression systems are most effective for recombinant Campylobacter membrane proteins?

Based on recombinant protein production approaches for Campylobacter proteins, several expression systems may be considered:

Expression SystemAdvantagesConsiderations for MscL
E. coliWell-established protocols, high yieldMay require optimization for membrane protein folding
YeastPost-translational modifications, eukaryotic machineryLower yields than bacterial systems
BaculovirusComplex protein folding, high expressionMore complex setup, longer production time
Mammalian CellNative-like folding and processingLowest yields, highest cost
The choice depends on research goals. E. coli systems are common for initial characterization, while other systems may be needed for functional studies .

What purification strategies are most effective for maintaining MscL channel functionality?

Effective purification strategies should:

  • Use gentle detergents that maintain the pentameric structure

  • Include lipid supplementation during purification to stabilize the channel

  • Employ affinity chromatography with tags that don't interfere with channel function

  • Avoid harsh conditions that could disrupt the oligomeric state

  • Consider reconstitution into proteoliposomes for functional studies
    Each step requires optimization specifically for C. concisus MscL to balance yield and functionality.

How can researchers assess the functional properties of recombinant C. concisus MscL?

Functional assessment methods include:

  • Patch clamp electrophysiology - Allows direct measurement of channel activity in response to pressure changes

  • Liposome swelling/shrinking assays - Measures channel-mediated solute flux

  • Fluorescence-based assays - Uses fluorescent dyes to detect changes in vesicle volume or membrane potential

  • In vivo osmotic shock survival assays - Tests complementation of MscL-deficient bacterial strains
    These approaches provide complementary data on channel gating properties, conductance, and physiological relevance.

How might C. concisus MscL contribute to pathogenesis and host-microbe interactions?

C. concisus has been associated with inflammatory bowel disease, Barrett's esophagus, and other gastrointestinal disorders . MscL may contribute to pathogenesis through:

  • Osmoadaptation during infection - Helping bacteria survive osmotic stress in the GI tract

  • Resistance to host defense mechanisms - Potentially aiding survival against antimicrobial peptides

  • Biofilm formation support - C. concisus forms biofilms on various surfaces , and MscL might help maintain membrane integrity during biofilm development

  • Interaction with host membranes - Potentially influencing attachment to or invasion of epithelial cells
    Understanding these interactions requires sophisticated co-culture models with intestinal and esophageal epithelial cell lines like HT-29 and FLO-1 .

How does C. concisus MscL compare to MscL channels in other gastrointestinal pathogens?

Comparative analysis requires:

  • Sequence alignment and structural modeling to identify unique features

  • Heterologous expression and functional comparison of MscL from multiple species

  • Assessment of channel properties under conditions mimicking the GI environment

  • Evaluation of channel contribution to virulence in different pathogens
    Such comparative approaches could identify C. concisus-specific adaptations relevant to its niche in the oral cavity and potential pathogenic role in the intestinal tract .

What experimental approaches are best for studying the role of MscL in C. concisus biofilm formation?

C. concisus has been shown to form biofilms on glass, stainless steel, and polystyrene surfaces . To study MscL's role:

  • Gene knockout/knockdown studies - Create MscL-deficient strains and assess biofilm formation capacity

  • Controlled expression systems - Use inducible promoters to modulate MscL expression levels

  • Real-time imaging - Monitor biofilm development with fluorescently-tagged MscL

  • Microfluidic devices - Create controlled microenvironments to assess biofilm formation under different pressure/flow conditions

  • Comparative genomics - Analyze MscL sequence variations among C. concisus strains with different biofilm-forming abilities

How can researchers address the genetic diversity of C. concisus strains when studying MscL?

C. concisus exhibits significant genetic diversity, with multiple genomospecies identified . Researchers should:

  • Sequence the MscL gene from multiple clinical and environmental isolates

  • Create a phylogenetic map of MscL sequence variation

  • Assess whether MscL variants correlate with disease association or isolation site

  • Consider using strains from both genomospecies clusters identified in recent studies

  • Test whether MscL function varies between oral isolates and intestinal isolates

What are the technical considerations for genetic manipulation of C. concisus to study MscL function?

C. concisus is more challenging to genetically manipulate than model organisms. Key considerations include:

  • Transformation efficiency - Optimize protocols specifically for C. concisus

  • Selection markers - Identify appropriate antibiotics and resistance genes

  • Vector design - Ensure compatibility with C. concisus replication machinery

  • Homologous recombination efficiency - May require longer homology arms than other bacteria

  • CRISPR-Cas9 adaptations - Modify systems for use in this fastidious organism

How might understanding C. concisus MscL contribute to therapeutic approaches for inflammatory bowel disease?

Research on C. concisus MscL could inform therapeutic strategies through:

  • Novel antimicrobial targets - MscL has been proposed as a potential antibiotic target

  • Understanding pathogenesis - Clarifying how C. concisus adapts to the intestinal environment

  • Biofilm disruption - Potentially targeting MscL to prevent biofilm formation

  • Host-microbe interaction modeling - Using MscL function to predict strain virulence potential

  • Diagnostic development - Correlation between MscL variants and disease phenotypes
    This research connects to broader investigations of C. concisus virulence factors, including the zonula occludens toxin that may contribute to intestinal barrier dysfunction in IBD .

What are the key considerations for designing experiments to study MscL function in the context of C. concisus pathogenesis?

Experimental design should address:

  • Physiological relevance - Test MscL function under conditions mimicking the human GI tract

  • Cell type selection - Use both intestinal (HT-29) and esophageal (FLO-1) cell lines as C. concisus affects both tissues differently

  • Inflammatory conditions - Include IFN-γ sensitization as it affects C. concisus-host interactions

  • Co-factor requirements - Consider C. concisus's hydrogen requirement in experimental setups

  • Strain selection - Include strains from different genomospecies clusters

  • Controls - Compare with other Campylobacter species, particularly C. jejuni
    Understanding MscL's role requires integrating data from multiple experimental approaches within a physiologically relevant framework.

How can researchers distinguish between direct effects of MscL and indirect effects through other bacterial processes?

This requires a multi-faceted approach:

  • Clean genetic models - Create MscL deletion, point mutation, and complementation strains

  • Controlled expression - Use inducible systems to modulate MscL expression levels

  • Domain swapping - Exchange domains between MscL proteins of different species

  • Inhibitor studies - Use specific MscL inhibitors when available

  • Temporal resolution - Monitor effects immediately following osmotic challenge versus long-term adaptation These approaches help establish causality rather than correlation when studying complex host-microbe interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.