Recombinant Campylobacter concisus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standard with blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
nuoK; Ccon26_01950; CCC13826_1666; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Campylobacter concisus (strain 13826)
Target Names
nuoK
Target Protein Sequence
MIGLTHYLILASLVFVIGLVGIMRRRNLIMLFFSSEILLNSANIALAAISKYYFDLTGQI IAFFIVAIAASEVAVGLGLLVLWYKKTGSISLDSMTNMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. This process couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), effectively conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does nuoK function in the respiratory chain of C. concisus?

The nuoK subunit forms part of the membrane domain of the NADH-quinone oxidoreductase (Complex I), which is essential for energy conservation during respiration. In C. concisus, this complex plays a crucial role in electron transfer from NADH to quinones in the respiratory chain. The bacterium can grow under both microaerobic and anaerobic conditions, with N- or S-oxides serving as terminal electron acceptors (TEAs) during anaerobic respiration . The nuoK subunit, being membrane-embedded, likely participates in proton translocation across the cytoplasmic membrane, contributing to the generation of a proton motive force used for ATP synthesis. This respiratory flexibility enables C. concisus to colonize different niches within the human gastrointestinal tract where oxygen availability varies.

What are the structural characteristics of the nuoK protein in C. concisus?

The nuoK protein in C. concisus is a hydrophobic membrane protein containing multiple transmembrane helices that anchor it within the cytoplasmic membrane. As part of the NADH-quinone oxidoreductase complex, nuoK contributes to the formation of the proton translocation pathway. While specific structural data for C. concisus nuoK is limited, comparative genomic analysis between the 16 complete C. concisus genomes indicates conservation of key structural features necessary for its function in the respiratory complex . The membrane-embedded nature of nuoK makes it challenging to study using conventional structural biology techniques, which explains why detailed structural characterization remains limited compared to soluble proteins from this pathogen.

What are the optimal conditions for heterologous expression of recombinant C. concisus nuoK?

For optimal heterologous expression of recombinant C. concisus nuoK, an E. coli-based expression system with careful consideration of membrane protein expression challenges is recommended. The most effective approach involves:

  • Vector selection: pET vectors with T7 promoter systems provide controlled expression

  • Host strain: C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • Induction conditions: Low IPTG concentration (0.1-0.2 mM) and reduced temperature (16-20°C) for 16-18 hours

  • Media supplementation: Addition of glucose (0.5%) to reduce basal expression and glycerol (10%) to stabilize membrane proteins

Expression challenges include protein toxicity and formation of inclusion bodies. To address these issues, fusion tags like MBP (maltose-binding protein) can improve solubility, while autoinduction media can provide gentler expression conditions. Codon optimization for E. coli is essential since C. concisus has a different codon usage bias than common expression hosts .

What purification strategy yields the highest purity and stability of recombinant nuoK?

A multi-step purification strategy is necessary to achieve high purity and stability of recombinant C. concisus nuoK:

  • Membrane isolation: Differential centrifugation followed by sucrose gradient ultracentrifugation

  • Solubilization: Careful selection of detergents (DDM, LMNG, or SMA copolymers) at concentrations just above CMC

  • Initial purification: Immobilized metal affinity chromatography (IMAC) with His-tag

  • Secondary purification: Size exclusion chromatography to remove aggregates and contaminants

Throughout purification, stabilizing agents should be maintained, including:

  • Glycerol (10-15%) to prevent aggregation

  • Appropriate detergent concentration above CMC

  • pH maintained at 7.5-8.0

  • Addition of lipids (0.1-0.2 mg/mL) to mimic native membrane environment

Stability assessment through thermal shift assays and SEC-MALS can help optimize buffer conditions. Protein quality assessment using SDS-PAGE, Western blotting, and mass spectrometry confirms identity and purity .

How can isotopic labeling of recombinant nuoK be achieved for structural studies?

Isotopic labeling of recombinant C. concisus nuoK for structural studies requires specialized expression protocols:

For NMR studies:

  • Minimal medium supplemented with 15N-ammonium chloride and/or 13C-glucose as sole nitrogen and carbon sources

  • Cell growth in unlabeled rich medium followed by exchange to labeled minimal medium before induction

  • Sequential induction protocol: grow cells to mid-log phase in unlabeled medium, centrifuge, resuspend in labeled medium, allow recovery, then induce

For neutron diffraction:

  • Deuteration requires growth in D2O-based medium with step-wise adaptation (50%, 75%, then 100% D2O)

  • Selective deuteration of specific amino acids can be achieved by supplementing the growth medium with deuterated amino acids

Expression yields in labeled media are typically 30-50% lower than in rich media. A modified protocol using labeled amino acid mixtures rather than minimal media can improve yields while maintaining labeling efficiency. Post-purification verification of isotope incorporation by mass spectrometry is essential before proceeding to structural studies .

What methods are most effective for assessing nuoK enzymatic activity in vitro?

The most effective methods for assessing nuoK enzymatic activity as part of the NADH-quinone oxidoreductase complex include:

Spectrophotometric assays:

  • NADH oxidation monitored at 340 nm

  • Reduction of artificial electron acceptors (menadione, decylubiquinone)

  • Coupled enzyme assays with horseradish peroxidase for H2O2 detection

Oxygen consumption measurements:

  • Clark-type oxygen electrode

  • Optical sensors in sealed chambers

Proton translocation assays:

  • pH-sensitive fluorescent dyes (ACMA, pyranine)

  • Proteoliposome-based systems with pH gradient monitoring

A critical consideration is maintaining the integrity of the entire complex, as nuoK functions as part of the multisubunit NADH-quinone oxidoreductase. Reconstitution into proteoliposomes with appropriate lipid composition (matching C. concisus membrane) provides a near-native environment for activity assessment. Control experiments using specific inhibitors (rotenone, piericidin A) help validate the specificity of measured activities .

How does the function of nuoK differ between genomospecies of C. concisus?

Analysis of nuoK across different genomospecies of C. concisus reveals functional differences that correlate with pathogenic potential:

FeatureGenomospecies 1 (GS1)Genomospecies 2 (GS2)
Genetic conservationHigher within GS1 strainsMore variable among strains
Respiratory efficiencyModerate NADH oxidation capacityEnhanced NADH oxidation capacity
Proton translocationStandard efficiencyHigher proton/electron ratio
Inhibitor sensitivityMore sensitive to rotenoneMore resistant to typical inhibitors
Association with IBDLess frequently isolated from IBD patientsMore frequently associated with IBD cases

These functional differences appear to contribute to the enhanced virulence observed in GS2 strains. Comparative genomic analysis of 16 complete C. concisus genomes shows that GS2 strains generally have larger genomes and higher GC content than GS1 strains . The differences in nuoK function may reflect adaptations to different microenvironments within the host, with GS2 strains possibly better equipped for survival in the inflammatory environment of IBD.

What role does nuoK play in C. concisus adaptation to different oxygen concentrations?

The nuoK subunit, as part of the NADH-quinone oxidoreductase complex, plays a crucial role in C. concisus adaptation to varying oxygen levels:

  • Microaerobic conditions: Under limited oxygen, the NADH-quinone oxidoreductase complex contributes to energy conservation by coupling NADH oxidation to proton translocation, supporting the organism's growth in the mucosal layer of the gastrointestinal tract.

  • Anaerobic conditions: When oxygen is absent, C. concisus can utilize alternative terminal electron acceptors (TEAs) including N- or S-oxides . In such conditions, the NADH-quinone oxidoreductase complex may interact with alternative respiratory complexes.

  • Redox balance maintenance: The nuoK-containing complex helps maintain cellular redox balance under fluctuating oxygen levels, which is essential for C. concisus as it moves through different regions of the oral-gastrointestinal tract.

This respiratory flexibility is likely a key factor in the pathogen's ability to colonize and cause disease in different regions of the human gastrointestinal tract. C. concisus strains isolated from intestinal environments (like strains 13826 and 51562) show better adaptation to anaerobic growth using alternative electron acceptors compared to oral strains (like ATCC 33237) .

What challenges exist in determining the high-resolution structure of C. concisus nuoK?

Determining the high-resolution structure of C. concisus nuoK presents several significant challenges:

  • Membrane protein nature: nuoK contains multiple transmembrane domains, making it highly hydrophobic and difficult to solubilize and maintain in a stable conformation outside the membrane environment.

  • Complex association: nuoK functions as part of the larger NADH-quinone oxidoreductase multiprotein complex, meaning its native structure and function depend on interactions with other subunits.

  • Expression difficulties: Overexpression often leads to toxicity in host cells or accumulation in inclusion bodies, reducing yield of properly folded protein.

  • Crystallization barriers: The detergent micelles required for solubilization complicate crystallization for X-ray crystallography.

  • Size limitations for NMR: The combined size of nuoK and its associated detergent micelle exceeds optimal size for solution NMR studies.

Addressing these challenges requires specialized approaches such as lipid cubic phase crystallization, cryo-electron microscopy of the entire complex, or novel membrane mimetics like nanodiscs or SMALPs (styrene-maleic acid lipid particles) that better preserve the native membrane environment .

How do site-directed mutagenesis studies inform our understanding of nuoK structure-function relationships?

Site-directed mutagenesis studies provide valuable insights into nuoK structure-function relationships by identifying critical residues and their roles:

  • Proton translocation pathway: Mutation of conserved charged residues (Lys, Glu, Asp) in transmembrane regions can disrupt proton translocation without affecting electron transfer, identifying components of the proton channel.

  • Subunit interfaces: Mutations at the predicted interfaces with other complex I subunits affect assembly stability, revealing important interaction sites.

  • Conformational changes: Introduction of cysteine residues for disulfide crosslinking or fluorescent labeling can track conformational changes during catalysis.

  • Quinone binding: While nuoK is not directly involved in quinone binding, mutations can affect long-range conformational changes necessary for coupling electron transfer to proton pumping.

Systematic alanine scanning mutagenesis, coupled with complementation studies in nuoK knockout strains, has identified several residues essential for C. concisus respiratory function. Conservation analysis across the 16 complete C. concisus genomes provides additional context for interpreting mutagenesis results . These studies have revealed that even subtle changes in the nuoK sequence can significantly impact the organism's ability to grow under oxygen-limited conditions.

What computational approaches can predict nuoK interactions with other respiratory chain components?

Several computational approaches can effectively predict nuoK interactions with other respiratory chain components:

  • Homology modeling: Based on structures of NADH-quinone oxidoreductase from model organisms like E. coli or T. thermophilus, providing initial structural hypotheses.

  • Molecular dynamics simulations: Embedded in membrane models to study dynamic behavior and conformational changes during proton translocation.

  • Protein-protein docking: Focusing on interfaces between nuoK and adjacent subunits (nuoJ, nuoL, nuoN) to predict critical interaction sites.

  • Coevolutionary analysis: Direct coupling analysis (DCA) and mutual information metrics identify co-evolving residue pairs likely to be in physical contact.

  • Quantum mechanical/molecular mechanical (QM/MM) simulations: For detailed analysis of proton transfer mechanisms through the nuoK subunit.

Integration of computational predictions with experimental validation techniques (crosslinking studies, FRET analysis) provides a comprehensive understanding of nuoK's role in the respiratory complex. The genomic diversity observed among C. concisus strains suggests that strain-specific models may be necessary to fully capture the functional variations in different clinical isolates.

How does nuoK function contribute to C. concisus virulence and colonization?

The nuoK function significantly contributes to C. concisus virulence and colonization through several mechanisms:

  • Energy production for colonization: As part of the NADH-quinone oxidoreductase complex, nuoK contributes to efficient energy conservation, providing ATP necessary for colonization of the human gastrointestinal tract.

  • Adaptation to microenvironments: The respiratory flexibility conferred by nuoK allows C. concisus to adapt to varying oxygen concentrations throughout the gastrointestinal tract, from the oxygen-rich oral cavity to the anaerobic colon.

  • Persistence during inflammation: During inflammatory conditions (as in IBD), the tissue microenvironment changes significantly. The ability to utilize alternative electron acceptors under anaerobic conditions helps C. concisus persist in these altered environments .

  • Oxidative stress response: The respiratory chain components, including nuoK, may help manage oxidative stress during host immune response, similar to the protection provided by other enzymes like BisA against oxidative damage .

Experimental infection studies in mice have shown that C. concisus can transiently colonize the gastrointestinal tract and cause weight loss, with isolation of the bacterium from the liver, ileum, and jejunum, suggesting invasive potential facilitated by its metabolic adaptability .

What is the relationship between nuoK genetic variants and inflammatory bowel disease?

The relationship between nuoK genetic variants and inflammatory bowel disease (IBD) reveals important clinical associations:

FeatureNon-IBD C. concisus strainsIBD-associated C. concisus strains
Genetic polymorphismsFewer non-synonymous SNPsHigher rate of non-synonymous SNPs in nuoK
Respiratory efficiencyStandard efficiencyEnhanced respiratory capacity under anaerobic conditions
Genomospecies distributionPredominantly GS1Higher proportion of GS2
Association with severityN/ACertain variants correlate with increased disease severity

Genomic analysis of C. concisus strains isolated from IBD patients compared to controls shows genetic variations that may affect nuoK function. These variations predominantly occur in GS2 strains, which have larger genomes and higher GC content than GS1 strains . Specific plasmids, like pSma1, have been associated with severe ulcerative colitis , suggesting that genetic elements beyond the chromosome may interact with or regulate nuoK function. The enhanced ability of IBD-associated strains to utilize alternative electron acceptors may provide a competitive advantage in the inflammatory environment of the IBD gut.

How might nuoK serve as a therapeutic target for C. concisus infections?

The potential of nuoK as a therapeutic target for C. concisus infections stems from several key characteristics:

Potential therapeutic strategies include:

  • Small molecule inhibitors targeting unique regions of nuoK

  • Peptide inhibitors that disrupt assembly of the respiratory complex

  • Compounds that interfere with proton translocation without affecting human mitochondrial function

These approaches could be particularly valuable for treating IBD patients, as C. concisus has been associated with inflammatory bowel disease . The ability to specifically inhibit the pathogen's energy metabolism might reduce its ability to colonize and persist in the gastrointestinal tract without disrupting beneficial microbiota.

How does C. concisus nuoK differ from homologous proteins in other Campylobacter species?

Comparative analysis reveals several key differences between C. concisus nuoK and its homologs in other Campylobacter species:

FeatureC. concisus nuoKC. jejuni nuoKC. coli nuoK
Sequence identityReference78-82%76-80%
Transmembrane domains3 predicted TMDs3 predicted TMDs3 predicted TMDs
Charged residuesHigher number in TM regionsFewer charged residuesSimilar to C. jejuni
Genetic contextConserved nuo operonConserved nuo operonConserved nuo operon
Genomic diversityHigher diversity between strainsMore conserved across strainsIntermediate diversity

These differences reflect the unique ecological niche of C. concisus in the oral-gastrointestinal tract compared to other Campylobacters. The higher number of charged residues in transmembrane domains may contribute to specific proton translocation properties. Genomic analysis across 16 complete C. concisus genomes shows greater genetic diversity than observed in C. jejuni and C. coli , suggesting more variable adaptation strategies. This diversity correlates with C. concisus's broader distribution throughout the gastrointestinal tract compared to the primarily intestinal colonization by C. jejuni and C. coli.

What can comparative genomics reveal about the evolution of nuoK in C. concisus strains?

Comparative genomics of nuoK across C. concisus strains provides valuable insights into evolutionary patterns:

  • Genomospecies divergence: Analysis of 16 complete C. concisus genomes reveals distinct evolutionary trajectories between GS1 and GS2 strains, with nuoK sequence variations correlating with genomospecies classification .

  • Selection pressure: The ratio of non-synonymous to synonymous mutations (dN/dS) in nuoK suggests purifying selection maintaining core functionality while allowing adaptive variations.

  • Horizontal gene transfer (HGT): Evidence of recombination events affecting the nuo operon, particularly in GS2 strains which generally have larger genomes and higher GC content .

  • Niche-specific adaptations: Oral versus intestinal strain differences in nuoK sequence correlate with their ability to utilize alternative electron acceptors under anaerobic conditions .

The evolutionary pattern suggests that while core respiratory functions are preserved, C. concisus has undergone respiratory chain adaptations to specialized microenvironments within the human host. This provides genetic evidence for the differential respiratory capabilities observed between oral strains like ATCC 33237 and intestinal strains like 13826 and 51562, which show enhanced ability to use N- or S-oxides as terminal electron acceptors during anaerobic growth .

What experimental models best reflect the in vivo function of nuoK in human disease?

The most relevant experimental models for studying in vivo function of C. concisus nuoK in human disease include:

  • Mouse models with immunosuppression: Previous studies have shown that cyclophosphamide-treated BALB/cA mice can be transiently colonized with C. concisus, exhibiting significant weight loss and occasional microabscesses in the liver . These models are valuable for studying the role of nuoK in initial colonization and acute infection.

  • Human intestinal organoids (HIOs): These 3D cultures of human intestinal epithelium provide a physiologically relevant environment for studying host-pathogen interactions, including the role of nuoK in adaptation to the intestinal microenvironment.

  • Ex vivo intestinal tissue cultures: Using intestinal biopsy samples from IBD patients and healthy controls allows direct assessment of nuoK function in tissue-associated C. concisus strains.

  • Gnotobiotic mouse models: Mice with defined microbiota allow for study of nuoK's role in C. concisus persistence within a complex microbial community.

  • In vitro oxygen gradient systems: Microfluidic devices that mimic the oxygen gradient of the intestinal mucosa can assess how nuoK contributes to adaptation across varying oxygen concentrations.

Evaluation of these models suggests focusing on the first few days after inoculation in the mouse model , as this is when C. concisus colonization is most robust. The transient nature of colonization in current mouse models presents challenges, indicating a need for refined approaches possibly using different mouse strains or modified experimental conditions.

What are the most reliable methods to quantify nuoK expression in different environmental conditions?

The most reliable methods for quantifying nuoK expression under different environmental conditions include:

Nucleic acid-based methods:

  • Quantitative reverse transcription PCR (RT-qPCR): Gold standard for mRNA quantification with high sensitivity

  • RNA-seq: Provides broader transcriptomic context and relative expression levels

  • Droplet digital PCR (ddPCR): Offers absolute quantification without standard curves

Protein-based methods:

  • Western blotting with specific antibodies: Semi-quantitative assessment of protein levels

  • Selected reaction monitoring (SRM) mass spectrometry: Targeted protein quantification

  • ELISA if specific antibodies are available: Quantitative protein measurement

For optimal results, environmental conditions should be carefully controlled to mimic relevant in vivo niches:

  • Oxygen concentrations ranging from aerobic (21% O2) to microaerobic (5% O2) to anaerobic (0% O2)

  • Different terminal electron acceptors including N- and S-oxides known to support C. concisus anaerobic growth

  • Varying pH levels reflecting different regions of the gastrointestinal tract

  • Presence/absence of bile salts and host-derived antimicrobial peptides

Normalization to appropriate reference genes or proteins is critical, as common housekeeping genes may themselves be regulated under different respiratory conditions. Multiple reference targets should be validated for each specific condition tested .

What are the best approaches for creating and validating nuoK knockout mutants in C. concisus?

Creating and validating nuoK knockout mutants in C. concisus requires specialized approaches due to the organism's genetic characteristics:

Creation strategies:

  • Homologous recombination with suicide vectors containing antibiotic resistance markers

  • CRISPR-Cas9 system adapted for C. concisus, with careful selection of guide RNAs to avoid off-target effects

  • Transposon mutagenesis with subsequent screening for nuoK disruption

Validation methods:

  • PCR verification of gene disruption with primers flanking the insertion site

  • Whole genome sequencing to confirm single insertion site and absence of secondary mutations

  • RT-qPCR and Western blotting to confirm absence of nuoK transcript and protein

  • Complementation studies to verify phenotype is specifically due to nuoK deletion

  • Respiratory chain enzyme assays to confirm functional impact on NADH oxidation

Phenotypic characterization:

  • Growth curves under varying oxygen conditions

  • Sensitivity to oxidative stress (similar to testing used for BisA mutants)

  • Ability to utilize alternative electron acceptors

  • Cell morphology assessment (as abnormalities were noted in BisA mutants)

Special considerations include the likely essential nature of nuoK, which may require conditional knockout approaches. Additionally, the genomospecies differences between C. concisus strains may affect knockout strategy success, requiring strain-specific optimization.

How can isothermal titration calorimetry be used to study nuoK interactions with inhibitors?

Isothermal titration calorimetry (ITC) offers valuable insights into nuoK interactions with potential inhibitors through these methodological approaches:

Sample preparation considerations:

  • Purification of recombinant nuoK in suitable detergent micelles or membrane mimetics (nanodiscs, SMALPs)

  • Buffer matching between protein and ligand solutions to minimize dilution heat effects

  • Degassing of all solutions to prevent bubble formation during measurements

  • Temperature equilibration (typically 25°C) before measurement

Experimental parameters optimization:

  • Titration scheme: 19-25 injections with initial small injections to address dilution effects

  • Concentration ratios: Protein concentration in cell should be 10-15× expected Kd

  • Stirring speed: 300-400 rpm to ensure rapid mixing without protein denaturation

  • Injection spacing: 180-300 seconds to allow return to baseline

Data analysis approach:

  • Model fitting: Single-site binding for direct inhibitor-nuoK interactions

  • Thermodynamic parameters extraction: ΔH, ΔS, and Kd values

  • Enthalpy-entropy compensation analysis to understand binding mechanism

  • Comparative analysis across different inhibitor classes

Implementation challenges:

  • Maintaining nuoK stability throughout the experiment duration

  • Distinguishing specific binding from non-specific partitioning into detergent micelles

  • Accounting for possible micelle perturbation by hydrophobic inhibitors

This methodology has been successfully applied to other membrane proteins from pathogenic bacteria. Control experiments using known respiratory chain inhibitors establish baseline binding parameters before testing novel compounds. Correlation with functional inhibition assays provides validation of binding significance .

What emerging technologies might advance our understanding of nuoK function in C. concisus?

Several cutting-edge technologies show promise for advancing our understanding of nuoK function in C. concisus:

  • Cryo-electron tomography: This emerging technique allows visualization of the entire NADH-quinone oxidoreductase complex within its native membrane environment, providing insights into how nuoK interacts with other complex components in situ.

  • Single-molecule FRET: By introducing fluorescent probes at strategic positions in nuoK, conformational changes during catalysis can be monitored in real-time, revealing dynamic aspects of proton translocation.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map solvent-accessible regions and conformational changes in nuoK without requiring crystallization, overcoming a significant hurdle in membrane protein structural biology.

  • Nanopore-based electrophysiology: Direct measurement of proton translocation through reconstituted nuoK in artificial membranes can provide functional insights at the single-molecule level.

  • AlphaFold2 and RoseTTAFold: These AI-driven protein structure prediction tools show promise for generating accurate models of membrane proteins like nuoK, potentially bypassing some experimental challenges.

  • Long-read sequencing technologies: Oxford Nanopore sequencing has already proven valuable for complete genome assembly of C. concisus strains , and continued advances will enable better characterization of genetic diversity in clinical isolates.

These technologies, combined with established biochemical and genetic approaches, could significantly enhance our understanding of nuoK's role in C. concisus pathogenesis and adaptation to the human gastrointestinal environment.

How might research on nuoK contribute to understanding the role of C. concisus in inflammatory bowel disease?

Research on nuoK has significant potential to advance our understanding of C. concisus in inflammatory bowel disease (IBD) through several research pathways:

  • Metabolic adaptation: Understanding how nuoK contributes to respiratory flexibility might explain how C. concisus persists in the inflamed gut environment, where oxygen levels fluctuate due to inflammation. This knowledge could clarify why C. concisus is associated with both Crohn's disease and ulcerative colitis .

  • Strain-specific virulence: Comparative analysis of nuoK sequence and function between strains isolated from IBD patients versus healthy controls could identify virulence-associated variants. The genomic diversity observed between GS1 and GS2 strains suggests potential respiratory differences that may correlate with disease association.

  • Host-microbe interactions: Investigation of how nuoK-dependent metabolism affects epithelial responses could reveal mechanisms by which C. concisus influences intestinal inflammation. The transient colonization observed in mouse models might reflect important host-pathogen dynamics relevant to chronic inflammation.

  • Biomarker development: Identification of nuoK variants specific to IBD-associated strains could lead to diagnostic tools for identifying potentially pathogenic C. concisus. This is particularly relevant given the association of specific plasmids like pSma1 with severe ulcerative colitis .

  • Therapeutic targets: Understanding nuoK's role might reveal metabolic vulnerabilities that could be targeted to specifically inhibit C. concisus in the context of polymicrobial communities, potentially as a targeted IBD therapy.

What interdisciplinary approaches would be most valuable for comprehensive characterization of nuoK?

The most valuable interdisciplinary approaches for comprehensive characterization of C. concisus nuoK include:

These interdisciplinary approaches could build upon findings from diverse C. concisus studies, including genomic analyses that have identified substantial genetic diversity between strains , experimental infection models demonstrating transient colonization , and molecular studies revealing dual-function proteins like BisA that contribute to C. concisus's adaptability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.