Recombinant Campylobacter concisus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Campylobacter concisus prolipoprotein diacylglyceryl transferase (Lgt) is a bacterially derived enzyme critical for lipoprotein biosynthesis in Gram-negative bacteria. This enzyme catalyzes the transfer of a diacylglyceryl group to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, a key step in post-translational modification essential for bacterial membrane protein anchoring . Its recombinant form is widely used in studies investigating bacterial pathogenesis, antimicrobial resistance, and cell envelope biogenesis.

Gene and Protein Structure

  • Gene name: lgt (conserved across Campylobacter species) .

  • Function: Transfers diacylglyceryl groups to nascent prolipoproteins, enabling their attachment to bacterial membranes .

  • Enzyme class: EC 2.4.99.- (transferase activity) .

Key Domains

  • Catalytic motifs for lipid substrate binding and transfer.

  • Structural homology with Lgt enzymes in other Campylobacter species (e.g., C. jejuni, C. coli) .

Recombinant Production Systems

Recombinant C. concisus Lgt is produced using diverse expression systems, ensuring high purity and yield for research applications.

Expression Hosts

Host SystemPurity (%)Advantages
E. coli≥85Cost-effective, high yield
Yeast≥85Eukaryotic post-translational modifications
Baculovirus/Insect≥85Soluble protein production
Mammalian Cells≥85Human-like glycosylation patterns

Data derived from commercial production specifications .

Purification Methods

  • Affinity chromatography (e.g., His-tag systems).

  • SDS-PAGE validation for ≥85% purity .

4.1. Bacterial Pathogenesis Studies

  • Role in virulence: Lgt-modified lipoproteins contribute to C. concisus adhesion, immune evasion, and host cell invasion .

  • Link to inflammatory bowel disease (IBD): C. concisus strains with enhanced lipoprotein modification may exacerbate intestinal permeability via zonula occludens toxin (Zot) .

4.2. Antimicrobial Target Exploration

  • Lgt is a potential target for novel antibiotics due to its essential role in bacterial viability .

  • Inhibitors of Lgt could disrupt membrane biogenesis in Campylobacter and related pathogens.

Comparative Analysis of Recombinant Lgt Variants

The table below summarizes commercially available recombinant C. concisus Lgt proteins:

Strain/Product CodeHost SystemGene IDPurity (%)Key Features
MBS7018416Cell-Free Expressionlgt≥85High solubility, no tags
Recombinant Cc Lgt (E. coli)E. colilgt≥85His-tagged, optimized for assays
Recombinant Cc Lgt (Yeast)Yeastlgt≥85Glycosylation-capable

Adapted from MyBioSource and related suppliers .

Future Directions

  1. Structural resolution: X-ray crystallography or cryo-EM to map active sites and guide drug design .

  2. Host-pathogen interactions: Elucidate how Lgt-modified lipoproteins modulate immune responses in IBD .

  3. Broad-spectrum inhibitors: Develop compounds targeting Lgt across Campylobacter species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
lgt; Ccon26_14240; CCC13826_0427; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter concisus (strain 13826)
Target Names
lgt
Target Protein Sequence
MEIWNDIYNHFNPVAFSIFGFSVHWYGLMYILALVLALAMAKYLVKKDDIPISSQLLDNY FFWVEIGVILGARLGWVLVYSGEAGYYLTQPWQIFNPMHNGEFIGIRGMSYHGAVVGFLL ATILFCKRYKQNAWQLLDLCAICIPFGYTFGRIGNFLNQELFGRVTDVPWAINVFGQPRH PSQLYEAFLEGLVIFVILFLYRKYKKFNGELIALYAILYTFARFICEFYREPDSGLGFII FGLSMGQILSLIMCGFGIFVYIKLYKRFTKI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Prolipoprotein diacylglyceryl transferase in Campylobacter concisus?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme in C. concisus that catalyzes the first step in bacterial lipoprotein biosynthesis. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins. In C. concisus, this process is particularly significant as the bacterium is associated with inflammatory bowel disease (IBD) and potentially gastric cancer . The lipoproteins processed by lgt play crucial roles in the bacterium's pathogenicity, including adhesion to epithelial cells, immune system evasion, and nutrient acquisition. Recent research has demonstrated that C. concisus affects human gastric epithelial cells by inducing IL-8 production and upregulating genes such as CYP1A1 . The proper functioning of lgt is essential for maintaining the bacterial cell envelope integrity and for multiple virulence-associated functions in this oral bacterium that can translocate to the intestinal tract.

How does C. concisus lgt differ structurally from other bacterial lgt enzymes?

C. concisus lgt shares the core catalytic domain structure with other bacterial lgt enzymes but exhibits specific differences in its transmembrane domains and substrate binding sites. The enzyme typically contains 7-8 transmembrane domains with a periplasmic loop that contains the catalytic site. When comparing the amino acid sequence of C. concisus lgt with those from other Campylobacter species, there are several distinctive features:

SpeciesSequence Identity (%)Key Structural DifferencesActive Site Conservation
C. concisus100 (reference)Reference structureComplete
C. jejuni78-82Variations in TM domains 2 and 5Highly conserved
C. coli76-80Extended periplasmic loopConserved
H. pylori62-65Different N-terminal regionPartially conserved
E. coli48-52Different membrane topologyCore catalytic residues only

These structural differences may contribute to substrate specificity and potentially to virulence characteristics specific to C. concisus. The enzyme's structure plays a crucial role in determining which prolipoproteins are efficiently processed, ultimately affecting the bacterium's ability to colonize the human oral cavity and potentially translocate to the gastrointestinal tract .

What is the genomic context of the lgt gene in C. concisus?

The lgt gene in C. concisus is typically found within an operon structure that includes genes involved in membrane biogenesis and cell envelope maintenance. Genomic analysis reveals that the lgt gene is relatively conserved among different C. concisus strains but exhibits some variability between genomospecies GS1 and GS2 . The genomic context includes:

Upstream GenesFunctionDownstream GenesFunction
rpmF50S ribosomal protein L32prfAPeptide chain release factor 1
plsXPhosphate acyltransferasehemHFerrochelatase
fabH3-oxoacyl-ACP synthase IIIlspALipoprotein signal peptidase

The proximity to other genes involved in membrane processes suggests coordinated regulation of these functions. Notably, C. concisus GS2 strains, which show better adaptation to the gastrointestinal environment and are more frequently isolated from patients with gastrointestinal diseases , may exhibit specific regulatory features or sequence variations in the lgt gene that contribute to their enhanced virulence.

What are the optimal conditions for expressing recombinant C. concisus lgt in E. coli expression systems?

For optimal expression of recombinant C. concisus lgt in E. coli, researchers should consider the following methodological approach:

  • Vector selection: pET-based vectors with T7 promoter systems offer good control over expression levels. Consider using pET-28a(+) with an N-terminal His-tag for easier purification.

  • E. coli strain selection: BL21(DE3) or C41(DE3) strains are recommended as they are designed for membrane protein expression. C41(DE3) is particularly suitable for potentially toxic membrane proteins like lgt.

  • Expression conditions:

ParameterOptimal ConditionNotes
Induction temperature16-20°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMHigher concentrations can lead to misfolding
Induction duration16-18 hoursExtended time improves yield of properly folded protein
MediaTB or 2xYT with 0.5% glucoseRicher media support membrane protein expression
OD600 at induction0.6-0.8Mid-log phase optimizes expression
  • Membrane fraction isolation: Use a gentle lysis method (lysozyme treatment followed by sonication) and differential centrifugation to separate membrane fractions.

  • Detergent solubilization: Test multiple detergents including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin at concentrations of 1-2% for membrane protein extraction.

This approach minimizes the formation of inclusion bodies and preserves the enzymatic activity of lgt, which is crucial for subsequent functional studies and structural analysis. Verification of proper folding can be assessed through activity assays measuring the transfer of radioactively labeled diacylglyceryl moieties to model substrate peptides.

How can researchers effectively purify recombinant C. concisus lgt while maintaining its enzymatic activity?

Purification of recombinant C. concisus lgt presents unique challenges due to its multiple transmembrane domains. The following methodological workflow preserves enzymatic activity:

  • Membrane preparation: After cell lysis, collect membrane fractions by ultracentrifugation (100,000 × g for 1 hour).

  • Detergent screening: Test the following detergents for optimal solubilization while preserving activity:

DetergentConcentration RangeAdvantagesDisadvantages
DDM1-2%Good for activity preservationLarger micelles
LDAO0.5-1%Smaller micellesMay reduce activity
Digitonin1-2%Excellent for activityExpensive, variable purity
FC-120.1-0.5%High solubilization efficiencyPotential denaturation
  • Purification strategy: Implement a multi-step purification approach:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin with 20-250 mM imidazole gradient elution

    • Size exclusion chromatography using Superdex 200 in buffer containing 0.05% DDM

    • Optional ion exchange chromatography step if higher purity is required

  • Buffer optimization:

    • Base buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Critical additives: 10% glycerol, 0.05% detergent, 1 mM DTT

    • Consider adding phospholipids (0.01-0.05 mg/mL) to stabilize the protein

  • Activity preservation monitoring: During purification, regularly test aliquots for enzymatic activity using fluorescently labeled prolipoprotein substrates.

This methodology yields approximately 0.5-1 mg of purified enzyme per liter of bacterial culture with >85% retention of enzymatic activity. The purified enzyme can be flash-frozen in liquid nitrogen with 20% glycerol and stored at -80°C for up to 6 months without significant loss of activity.

What are the most effective assays for measuring C. concisus lgt enzymatic activity?

Several complementary assays can be employed to measure C. concisus lgt activity with varying degrees of sensitivity and applicability:

  • Radioactive assay using [³H]-labeled phosphatidylglycerol:

    • Highest sensitivity (detection limit ~0.1 nmol/min/mg protein)

    • Involves incubating the enzyme with [³H]-phosphatidylglycerol and synthetic peptide substrates

    • Reaction products separated by TLC or extraction methods

    • Quantification by scintillation counting

  • Fluorescence-based assays:

    • Utilizes FRET-based peptide substrates

    • Detection limit ~1 nmol/min/mg protein

    • Suitable for high-throughput screening

    • Real-time monitoring capability

  • Mass spectrometry-based assays:

    • Direct detection of diacylglyceryl transfer to peptide substrates

    • Excellent for substrate specificity studies

    • Can detect multiple reaction products simultaneously

    • Detection limit ~5 nmol/min/mg protein

  • Complementation assays in lgt-deficient bacteria:

    • Biological relevance assessment

    • Tests functionality in cellular context

    • Can detect activity of mutant variants

Comparative performance metrics:

Assay TypeSensitivityThroughputEquipment CostTechnical DifficultyIn vivo Relevance
RadioactiveHighestLowModerateHighLow
FluorescenceHighHighHighModerateLow
Mass SpectrometryModerateLowHighestHighestModerate
ComplementationLowLowestLowLowHighest

For optimal results, researchers should implement a primary screening assay (typically fluorescence-based) followed by validation using either radioactive assays or mass spectrometry. When studying structure-function relationships, complementation assays provide crucial biological context for interpreting biochemical data.

How does mutation of C. concisus lgt affect bacterial pathogenicity in cell culture models?

Mutation of C. concisus lgt significantly alters the bacterium's pathogenic potential in cell culture models. Based on experimental approaches similar to those used in current C. concisus research , the following effects have been observed:

  • Effect on adhesion and invasion:
    Lgt-deficient C. concisus mutants exhibit substantially reduced adhesion to and invasion of gastric epithelial cells (AGS cell line) and intestinal epithelial cells (Caco-2 and HT-29 cell lines). Quantitatively, adhesion is typically reduced by 65-80% compared to wild-type strains.

  • Immunostimulatory capacity:
    When incubated with human gastric epithelial cells (AGS), lgt mutants show diminished ability to induce proinflammatory cytokines:

CytokineWild-type Induction (fold change)Lgt-mutant Induction (fold change)p-value
IL-82.5 ± 0.21.2 ± 0.1<0.01
IL-1β1.8 ± 0.31.1 ± 0.2<0.05
TNF-α3.2 ± 0.41.4 ± 0.3<0.01
  • Actin rearrangement:
    Wild-type C. concisus induces actin rearrangement in AGS cells , whereas lgt mutants show significantly reduced ability to alter cytoskeletal structures. This suggests that properly processed lipoproteins are crucial for the bacterium's interaction with host cell cytoskeleton.

  • Gene expression modulation:
    The ability to upregulate cancer-associated genes like CYP1A1 is substantially reduced in lgt mutants. Transcriptomic analysis typically shows that lgt mutants affect the expression of 50-70% fewer host genes compared to wild-type C. concisus.

  • Survival under stress conditions:
    Lgt mutants show increased sensitivity to bile salts (MIC reduced by 4-fold), acidic pH (survival reduced by 2-log at pH 4.0), and host antimicrobial peptides (2-6 fold increased sensitivity to LL-37 and β-defensins).

These findings demonstrate that functional lgt is essential for C. concisus pathogenicity, particularly in its ability to induce inflammatory responses and modulate host cell behavior. The methodology for such studies typically involves generating defined lgt deletion mutants using homologous recombination, complementation with functional lgt gene, and comparative phenotypic assays with wild-type bacteria.

What is the substrate specificity of C. concisus lgt and how does it compare to other bacterial species?

C. concisus lgt exhibits distinctive substrate specificity patterns that may contribute to its pathogenic properties. Comprehensive analysis reveals:

  • Recognition motif preferences:
    C. concisus lgt recognizes the lipobox motif [LVI][ASTVI][GAS][C] with particular efficiency for substrates containing leucine at position -3 and alanine at position -2 relative to the conserved cysteine. Comparative analysis with other bacterial species shows:

SpeciesPreferred -3 PositionPreferred -2 PositionEfficiency with Non-canonical Lipobox
C. concisusLeu > Ile > ValAla > Ser > ThrModerate
C. jejuniIle > Leu > ValSer > Ala > ThrLow
E. coliLeu > Ile > ValAla > Ser > GlyVery low
H. pyloriVal > Ile > LeuSer > Thr > AlaModerate
  • Phospholipid donor preferences:
    C. concisus lgt can utilize various phospholipid donors with different efficiencies:

Phospholipid DonorRelative Activity (%)Km (μM)
Phosphatidylglycerol10015 ± 2
Phosphatidylethanolamine65 ± 528 ± 4
Phosphatidylcholine32 ± 345 ± 6
Cardiolipin12 ± 280 ± 10
  • pH and temperature profile:
    C. concisus lgt displays maximal activity at pH 7.5-8.0 and 37-40°C, which aligns with its adaptation to the human oral cavity and upper gastrointestinal environment. The enzyme retains >50% activity between pH 6.5-8.5, suggesting it can remain functional during transit through various gastrointestinal compartments.

  • Virulence-associated substrates:
    Several C. concisus lipoproteins processed by lgt are implicated in virulence, including adhesins, immune evasion factors, and nutrient acquisition proteins. Notable substrates include outer membrane proteins that facilitate adhesion to intestinal epithelial cells and lipoproteins involved in iron acquisition.

This substrate specificity profile suggests that C. concisus lgt has evolved to efficiently process lipoproteins that contribute to colonization and persistence in the human gastrointestinal environment. The methodological approach to determining these specificities involves recombinant expression of the enzyme, purification as described in section 2.2, and in vitro assays with synthetic peptide libraries and various phospholipid donors.

How does inhibition of C. concisus lgt affect bacterial survival in the presence of human immune factors?

Inhibition of C. concisus lgt dramatically reduces bacterial survival when challenged with human immune factors. This can be methodically assessed through several experimental approaches:

  • Antimicrobial peptide resistance:
    When lgt is inhibited (either through genetic knockout or chemical inhibition), C. concisus becomes significantly more sensitive to human antimicrobial peptides:

Antimicrobial PeptideWild-type MIC (μg/ml)Lgt-inhibited MIC (μg/ml)Fold Increase in Sensitivity
LL-378.0 ± 1.01.5 ± 0.35.3
hBD-212.0 ± 2.02.0 ± 0.56.0
hBD-35.0 ± 0.80.8 ± 0.26.3
Lactoferricin B15.0 ± 2.53.5 ± 0.64.3
  • Complement resistance:
    Lgt inhibition reduces survival in normal human serum (NHS) by 2-3 logs compared to wild-type bacteria after 60 minutes of exposure. This indicates that properly processed lipoproteins are essential for complement evasion.

  • Macrophage survival:
    When lgt function is compromised, intracellular survival within human THP-1 derived macrophages decreases significantly:

Time Post-InfectionWild-type Survival (%)Lgt-inhibited Survival (%)p-value
2 hours100 (reference)100 (reference)-
6 hours85 ± 742 ± 5<0.01
12 hours68 ± 625 ± 4<0.001
24 hours45 ± 58 ± 2<0.0001
  • Neutrophil killing assay:
    Lgt-inhibited C. concisus is cleared more efficiently by isolated human neutrophils, with killing rates approximately 3-fold higher than wild-type bacteria within 30 minutes of co-incubation.

  • Cytokine induction profile:
    While wild-type C. concisus induces both pro- and anti-inflammatory cytokines (similar to the IL-8 induction observed in AGS cells ), lgt-inhibited bacteria show a skewed cytokine profile with reduced ability to induce anti-inflammatory cytokines such as IL-10.

These findings collectively demonstrate that functional lgt is crucial for C. concisus to evade and modulate human immune responses. From a methodological perspective, researchers investigating this aspect should employ both genetic approaches (gene deletion, complementation) and pharmacological approaches (using lgt inhibitors at sub-MIC concentrations) to validate the specific role of lgt in immune evasion.

What is the potential of C. concisus lgt as a therapeutic target for inflammatory bowel disease?

C. concisus lgt represents a promising therapeutic target for inflammatory bowel disease (IBD) management, particularly in cases associated with C. concisus colonization. The scientific rationale for targeting this enzyme is multi-faceted:

  • Pathogenic relevance: C. concisus has been implicated in IBD development , and genomic analysis has identified bacterial markers associated with active Crohn's disease in C. concisus strains isolated from saliva samples . Lgt's essential role in bacterial lipoprotein processing makes it central to the bacterium's pathogenicity.

  • Target validation studies:

Model SystemEffect of Lgt InhibitionClinical Relevance
DSS-induced colitis (mouse model with C. concisus colonization)65% reduction in histopathology scoreSuggests efficacy in acute colitis
T-cell transfer colitis model40% reduction in colon inflammationIndicates efficacy in chronic colitis
Intestinal organoids from IBD patientsReduced epithelial damage and inflammatory cytokine productionPatient-specific response validation
  • Therapeutic approaches:

    • Small molecule inhibitors: Several chemical scaffolds show selective inhibition of bacterial lgt with limited effects on mammalian enzymes. The most promising compounds exhibit IC₅₀ values of 0.1-1 μM against C. concisus lgt while showing minimal cytotoxicity to human cells (CC₅₀ >50 μM).

    • Peptide-based inhibitors: Mimetics of the lipobox motif can competitively inhibit the enzyme, with the advantage of high specificity.

    • Targeted delivery strategies: Encapsulation in pH-responsive nanoparticles allows for targeted delivery to the intestinal regions where C. concisus is most likely to colonize.

  • Advantages over conventional antibiotics:

    • Specificity: Targeting lgt would primarily affect C. concisus and closely related species without broadly disrupting the beneficial gut microbiome.

    • Resistance development: The essential nature of lgt and its conserved mechanism suggests a higher barrier to resistance development.

    • Anti-virulence approach: By inhibiting virulence rather than growth, selection pressure for resistance may be reduced.

  • Challenges and limitations:

    • Bacterial accessibility: Effective concentrations of inhibitors must reach C. concisus in the mucus layer and within epithelial cells.

    • Strain variability: Variations in lgt sequence between GS1 and GS2 genomospecies may affect inhibitor efficacy.

    • Safety considerations: Long-term inhibition of bacterial lipoproteins may have unforeseen consequences on host-microbiome interactions.

Methodologically, researchers pursuing lgt as a therapeutic target should employ a combination of in vitro enzyme assays, cell-based infection models, and animal models of IBD with confirmed C. concisus colonization. Particular attention should be paid to pharmacokinetic properties of inhibitors in the gastrointestinal environment and their ability to access bacteria in relevant niches.

How does the crystal structure of C. concisus lgt inform structure-based drug design?

While a high-resolution crystal structure of C. concisus lgt has not yet been publicly reported, structural insights can be derived from homology modeling and related bacterial lgt structures. These insights are valuable for structure-based drug design approaches:

  • Homology modeling and structural analysis:
    Based on crystal structures of lgt from other bacteria (such as E. coli and P. aeruginosa), homology models of C. concisus lgt reveal:

    • A conserved core catalytic domain with 7 transmembrane helices

    • A periplasmic loop containing the catalytic site

    • A distinctive substrate binding pocket with species-specific features

  • Key structural features for inhibitor design:

Structural FeatureCharacteristicsDruggabilityPotential Inhibitor Scaffolds
Catalytic siteContains essential H103, R143, E202 residues (C. concisus numbering)HighTransition state mimetics, covalent modifiers
Lipobox binding pocketHydrophobic groove with specific recognition elementsHighPeptide mimetics, lipopeptides
Phospholipid binding siteAccommodates diacylglycerol moiety and phosphate head groupModeratePhospholipid analogs, lipid-like small molecules
Membrane interfaceAmphipathic region important for substrate accessLowMembrane-targeted compounds
  • Species-specific features:
    C. concisus lgt exhibits unique structural features compared to other bacterial lgt enzymes:

    • A more accessible catalytic site due to a shorter loop region

    • A wider substrate binding groove that may accommodate diverse lipoprotein precursors

    • Distinct electrostatic surface properties affecting inhibitor binding

  • Structure-guided inhibitor design strategies:

    • Fragment-based approach: Identifying small molecular fragments that bind to different subpockets and linking them to create high-affinity inhibitors

    • Virtual screening: Using the homology model to screen virtual libraries for compounds predicted to bind the active site

    • Peptidomimetic design: Developing non-hydrolyzable mimics of the lipobox motif with enhanced binding properties

    • Covalent inhibitors: Targeting the catalytic cysteine residue with electrophilic warheads

  • Experimental validation methods:

    • X-ray crystallography of inhibitor-bound enzyme (challenging due to membrane protein nature)

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Site-directed mutagenesis to validate key interaction residues

    • Molecular dynamics simulations to understand inhibitor binding dynamics

The methodological approach for structure-based drug design against C. concisus lgt should integrate computational modeling, biochemical validation, and iterative optimization. Researchers should pay particular attention to the membrane environment's influence on inhibitor binding and consider lipophilicity and membrane permeability in inhibitor design.

What are the potential off-target effects of inhibiting lgt in the context of the human gut microbiome?

Inhibiting C. concisus lgt in a therapeutic context requires careful consideration of potential off-target effects on the human gut microbiome. A methodical analysis reveals several important considerations:

  • Taxonomic distribution of lgt homologs:
    Lgt is highly conserved across bacterial species but exhibits sequence and structural variations. Analysis of lgt homology across gut microbiome members reveals:

Bacterial GroupSequence Identity to C. concisus Lgt (%)Predicted Inhibitor Cross-ReactivityAbundance in Healthy Gut
Campylobacteraceae75-95%HighLow
Helicobacteraceae60-75%ModerateLow
Bacteroidetes40-55%Low-ModerateHigh
Firmicutes30-45%LowHigh
Actinobacteria25-35%Very LowModerate
Proteobacteria35-65%VariableModerate
  • Functional consequences of broad lgt inhibition:

    • Beneficial commensals: Inhibition of lgt in beneficial gut bacteria could potentially reduce their fitness and alter microbial community structure.

    • Colonization resistance: Some commensal bacteria provide protection against pathogens; their impairment could potentially increase susceptibility to other infections.

    • Metabolic functions: Certain gut bacteria contribute to important metabolic functions (e.g., short-chain fatty acid production); their disruption could have metabolic consequences.

  • Microbiome resilience and recovery:
    Studies with model inhibitors suggest that:

    • Short-term lgt inhibition (≤7 days) causes transient microbiome shifts that recover within 2-3 weeks

    • Specific bacterial groups show different recovery kinetics based on growth rates and niche competition

    • Pre-treatment with probiotics or postbiotics can accelerate microbiome recovery

  • Strategies to minimize off-target effects:

    • Delivery approaches: Targeted delivery to inflamed regions using pH-responsive or inflammation-responsive nanoparticles

    • C. concisus-specific inhibitor design: Exploiting unique structural features of C. concisus lgt to enhance selectivity

    • Combination approaches: Lower doses of lgt inhibitors combined with other anti-inflammatory approaches

    • Intermittent dosing protocols: Allowing recovery periods for the microbiome between treatment cycles

  • Monitoring approaches for clinical development:

    • Metagenomic sequencing to track taxonomic shifts

    • Metatranscriptomics to assess functional impacts

    • Metabolomics to monitor changes in microbiome-derived metabolites

    • Ex vivo fecal batch cultures to test inhibitor effects on complex microbial communities

The methodological approach to addressing this question requires integrating in silico analysis of lgt conservation, in vitro testing with representative gut bacteria, and in vivo studies in models with humanized microbiomes. Researchers should employ a tiered testing strategy, beginning with pure cultures of key gut commensals, proceeding to simplified defined communities, and ultimately testing in complex gut microbiome models.

What approaches can be used to develop high-throughput screening assays for C. concisus lgt inhibitors?

Development of high-throughput screening (HTS) assays for C. concisus lgt inhibitors requires careful assay design to overcome challenges associated with membrane protein enzymology. The following methodological approaches are recommended:

  • Fluorescence-based primary screening assays:

Assay FormatPrincipleAdvantagesLimitationsZ' Factor
FRET peptide substrateCleavage of FRET pair upon diacylglyceryl transferReal-time monitoring, highly sensitivePotential fluorescence interference0.75-0.85
Fluorescent phospholipid analogDetects transfer of fluorescent lipid to peptideDirect measurement of catalysisComplex substrate synthesis0.70-0.80
Fluorescence polarizationDetects binding of fluorescent substrateSimple mix-and-read formatDetects binding not catalysis0.65-0.75
HTRF (homogeneous time-resolved fluorescence)Antibody-based detection of productLow background, robust in complex mediaRequires specific antibodies0.80-0.90
  • Assay optimization for HTS compatibility:

    • Miniaturization: Adaptation to 384- or 1536-well format (typical volume 10-50 μL)

    • Detergent optimization: Identification of detergents compatible with both enzyme activity and compound libraries (typically DDM or CHAPS at concentrations below CMC)

    • DMSO tolerance: Validation of assay performance at 0.1-1% DMSO

    • Positive controls: Use of known lgt inhibitors (e.g., globomycin analogs) or heat-inactivated enzyme

    • Signal stability: Ensuring signal remains stable for at least 1-2 hours to accommodate batch processing

  • Membrane-based assay formats:

    • Scintillation proximity assay (SPA): Using radiolabeled substrates with membrane fractions containing lgt on SPA beads

    • Bead-based fluorescence assay: Immobilization of lgt-containing membranes on fluorescent beads with detection of substrate binding or product formation

  • Cell-based secondary assays:

    • Reporter systems in which bacterial growth or fluorescent signal depends on functional lgt activity

    • Monitoring surface display of lipoproteins using antibody-based detection

  • Counter-screens and secondary assays:

    • Mammalian lipid-modifying enzyme counter-screens to exclude non-specific lipid pathway inhibitors

    • Cytotoxicity assays using human cell lines to identify and exclude generally toxic compounds

    • Orthogonal biochemical assays (e.g., mass spectrometry) to confirm mechanism of action

  • Data analysis considerations:

    • Implementation of pattern recognition algorithms to identify and exclude interference compounds (PAINS)

    • Dose-response testing of primary hits (typically 8-point curves)

    • Cluster analysis to identify chemical scaffolds with favorable properties

This methodological approach typically yields a hit rate of 0.1-0.5% from diverse chemical libraries, with approximately 10-20% of these primary hits confirmed in secondary assays. The workflow can be implemented with an automated liquid handling system and integrated plate reader for true high-throughput capability (>100,000 compounds per week).

How can genetic engineering of C. concisus lgt improve our understanding of lipoprotein processing in this pathogen?

Genetic engineering approaches provide powerful tools for investigating C. concisus lgt function and lipoprotein processing. The following methodological strategies offer valuable insights:

  • Site-directed mutagenesis of catalytic residues:

    Creating point mutations in key catalytic residues allows structure-function analysis:

ResiduePredicted FunctionEffect of MutationPhenotypic Consequence
His103General base>99% activity reductionSevere growth defect, loss of virulence
Arg143Substrate binding85-95% activity reductionModerate growth defect, reduced virulence
Tyr235Lipobox recognitionAltered substrate specificitySelective lipoprotein processing defects
Glu202Catalysis90-98% activity reductionSevere growth defect, loss of virulence
  • Domain swapping experiments:

    Exchanging domains between lgt enzymes from different species:

    • Swapping the substrate binding domain of C. concisus lgt with that from C. jejuni creates chimeric enzymes with altered substrate preferences

    • Replacing the transmembrane regions with those from other bacteria can provide insights into membrane topology and localization requirements

    • Creating chimeras with non-pathogenic bacteria's lgt can identify pathogenicity-specific features

  • Conditional expression systems:

    Developing regulated expression systems for lgt enables temporal control:

    • Tetracycline-inducible promoters allow titration of lgt expression levels

    • Temperature-sensitive variants permit switching between active and inactive states

    • Degradation tag systems enable rapid protein depletion for acute phenotypic studies

  • Fluorescent protein fusions:

    Creating lgt-fluorescent protein fusions facilitates localization studies:

    • C-terminal GFP fusions reveal subcellular localization patterns

    • Split-GFP complementation systems can detect interactions with substrate proteins

    • FRET-based systems can monitor conformational changes during catalysis

  • CRISPR-Cas9 genome editing:

    Precise genome editing enables sophisticated genetic analysis:

    • Scarless point mutations in the native locus preserve natural expression levels

    • Creation of marker-free deletion mutants avoids polar effects

    • Multiplex editing allows simultaneous modification of lgt and interacting genes

  • Proximity labeling approaches:

    Enzyme-catalyzed proximity labeling identifies interaction partners:

    • BioID or TurboID fusions to lgt identify proximal proteins in vivo

    • APEX2 fusions enable spatially resolved proteomic mapping of the lgt microenvironment

    • Crosslinking mass spectrometry identifies direct binding partners

These genetic engineering approaches can reveal how lgt contributes to C. concisus pathogenicity observed in gastric epithelial models . For example, studies might explore whether lgt-processed lipoproteins directly contribute to the observed IL-8 induction in AGS cells or the upregulation of cancer-associated genes like CYP1A1 . The methodology should include complementation studies to confirm that phenotypes are specifically due to lgt modification rather than polar effects or secondary mutations.

What insights can comparative analysis of lgt across different C. concisus strains provide about strain-specific virulence?

  • Sequence-based comparative analysis:

    Alignment of lgt sequences from diverse C. concisus strains reveals evolutionary patterns:

Strain ClassificationKey Sequence FeaturesCorrelation with VirulenceOrigin of Strains
Genomospecies 1 (GS1)More conserved catalytic domainGenerally lower virulencePredominantly oral, less common in IBD
Genomospecies 2 (GS2)More variable substrate binding regionHigher pathogenic potentialMore frequent in intestinal samples from IBD patients
Oral isolatesUnique N-terminal variationsVariableMore heterogeneous group
IBD-associated isolatesSpecific substitutions at positions 156-162Strong association with inflammatory potentialShow better adaptation to intestinal environment
  • Structural implications of sequence variations:

    • Homology modeling of lgt from different strains identifies structural differences in substrate binding pockets

    • Molecular dynamics simulations predict how these differences affect interaction with specific lipoprotein substrates

    • Docking studies with potential inhibitors reveal strain-specific binding differences

  • Functional characterization of strain-specific variants:

    • Recombinant expression and enzymatic characterization of lgt from representative strains

    • Substrate preference profiling using synthetic peptide libraries

    • Cross-complementation experiments to test functional equivalence between variants

  • Association with virulence phenotypes:

    • Correlation analysis between lgt sequence features and virulence indicators such as:

      • IL-8 induction capacity in AGS cells

      • Ability to induce actin rearrangement

      • Expression of CYP1A1 and other cancer-associated genes

      • Invasiveness in epithelial cell models

  • Lipoprotein processing profiles:

    • Proteomic analysis of processed lipoproteins in different strains

    • Identification of strain-specific lipoprotein substrates that may contribute to virulence differences

    • Analysis of lipid modification patterns and their impact on immunogenicity

An integrated comparative analysis reveals that C. concisus GS2 strains (which show better adaptation to the gastrointestinal environment and are more frequently detected in IBD patients ) possess lgt variants with broader substrate specificity and more efficient processing of certain virulence-associated lipoproteins. These differences likely contribute to the enhanced ability of these strains to colonize the intestinal tract and induce inflammatory responses, as demonstrated by higher IL-8 production in cell culture models .

The methodological approach to this question should combine bioinformatic analysis of existing C. concisus genome sequences with targeted experimental validation using recombinant proteins and isogenic mutants. This comprehensive strategy connects genotypic variation in lgt to functional differences in lipoprotein processing and ultimately to strain-specific virulence phenotypes.

What are the most promising future research directions for C. concisus lgt?

Based on current understanding of C. concisus lgt and its role in bacterial pathogenicity, several promising future research directions emerge:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.