Recombinant Campylobacter concisus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
htpX; Ccon26_06380; CCC13826_0879; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Campylobacter concisus (strain 13826)
Target Names
htpX
Target Protein Sequence
MEIFKTAFLMVALMLVFIAVGGYVGGEQGMMIAFLMAAGMNIFSYFFSDKLVLKRYNAIP VDENNAHGLYEIVSRLTQKANLPMPKIYIIPEEVPNAFATGRNPSHAAVAVTEGLLKILN ENEIEGVLAHELSHVRHYDILTGSVAAILAGAIAMVANFAKIGTLAGQNQNSQRNANPVI MLIIAVVMPLAATVIQMAISREREYKADKGAAYLTGHPEWLASALTKLENYSNSYVMQNA SEQSAHMFIVNPFGSLTSKLSVLFRTHPSTSDRIAELQRLEQEIKRGM
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter concisus Protease HtpX and what is its genomic location?

Protease HtpX is a putative virulence protein expressed by Campylobacter concisus, an oral bacterium associated with intestinal diseases including inflammatory bowel disease (IBD). The htpX gene is located at locus tag CCC13826_1039 in the C. concisus genome . HtpX belongs to a family of proteases that perform essential functions in bacterial protein quality control and stress response. In C. concisus, HtpX appears to be constitutively expressed regardless of growth conditions, suggesting its importance for basic cellular functions beyond pathogenicity alone .

How does C. concisus colonize different human anatomical sites?

C. concisus primarily colonizes the human oral cavity but can translocate to the intestinal tract in some individuals . The bacterium was initially described as requiring H₂-enriched microaerobic conditions for growth, despite H₂ levels in the oral cavity being extremely low . Research has demonstrated that 92% of oral C. concisus strains and all tested enteric strains can grow under anaerobic conditions without H₂, though H₂ significantly enhances growth . This metabolic flexibility likely explains how C. concisus successfully colonizes both the oral cavity (typically anaerobic) and potentially the intestinal tract, where it has been associated with inflammatory conditions .

What techniques are used to isolate and identify C. concisus strains from clinical samples?

C. concisus isolation from clinical samples typically involves:

  • Collection of oral samples (saliva, gingival plaque) or intestinal samples (biopsies, fecal samples)

  • Culturing on Horse Blood Agar (HBA) plates under appropriate atmospheric conditions

  • Incubation at 37°C for 48 hours

  • Confirmation through molecular techniques

For accurate identification and strain typing, researchers employ Multilocus Sequence Typing (MLST) analyzing six housekeeping genes (including aspA and tkt) . This approach has revealed considerable genetic diversity, with different individuals harboring distinct C. concisus strains that vary across all six housekeeping genes . Protein profiling through SDS-PAGE and mass spectrometry analysis provides further strain characterization .

How can I express and purify recombinant C. concisus HtpX protein for functional studies?

The recombinant expression and purification of C. concisus HtpX can be achieved through the following methodological approach:

  • Gene Amplification: PCR-amplify the htpX gene (locus CCC13826_1039) from C. concisus genomic DNA using sequence-specific primers .

  • Cloning Strategy: Clone the amplified gene into an expression vector (pET or pGEX systems) containing an N-terminal or C-terminal affinity tag (His₆ or GST).

  • Expression Conditions: Transform into E. coli BL21(DE3) and induce protein expression with IPTG, typically at lower temperatures (16-25°C) to enhance solubility.

  • Purification Protocol: Lyse cells under native conditions and purify using affinity chromatography followed by size-exclusion chromatography.

  • Validation: Confirm protein identity via Western blot and mass spectrometry analysis, similar to approaches used to identify native HtpX in C. concisus studies .

For functional characterization, ensure that the recombinant protein maintains its proper folding and activity by testing proteolytic function against known substrates under conditions that mimic both aerobic and anaerobic environments.

What growth conditions should be used to study HtpX expression in C. concisus?

To effectively study HtpX expression in C. concisus, researchers should consider multiple growth conditions to capture the protein's expression patterns. Based on experimental evidence, the following conditions are recommended:

Growth ConditionSystemH₂ ConcentrationIncubation ParametersSuitable Applications
Anaerobic with H₂Gas-generation system AN25A + NaBH₄2.5%, 5.0%, or 10.0%48h at 37°CNatural oral environment simulation
Anaerobic without H₂Gas-generation system AN25A0%48h at 37°CBaseline expression analysis
Microaerobic with H₂Gas-generation system CN25A + NaBH₄2.5%, 5.0%, or 10.0%48h at 37°CIntestinal environment simulation
Microaerobic without H₂Gas-generation system CN25A0%48h at 37°CStress response studies

How do I analyze genetic diversity of htpX genes in clinical isolates?

Analyzing genetic diversity of htpX genes in clinical isolates requires a multi-faceted approach:

  • Strain Collection: Isolate C. concisus from different anatomical sites (oral cavity, intestinal biopsies) and patient populations (IBD patients, healthy controls) .

  • PCR Amplification: Design primers targeting conserved regions flanking the htpX gene.

  • Sequencing Strategy: Perform Sanger sequencing of amplicons or whole-genome sequencing for comprehensive analysis.

  • Sequence Alignment: Align sequences using MUSCLE or CLUSTAL algorithms to identify polymorphisms.

  • Phylogenetic Analysis: Construct phylogenetic trees using maximum likelihood or Bayesian methods to determine evolutionary relationships.

Studies have shown that C. concisus exhibits remarkable genetic diversity, with patients harboring multiple strains showing natural recombination . For instance, in one study, five sequence types (ST7-ST11) were identified in oral isolates from a single patient, with ST9, ST10, and ST11 appearing to be recombinants of two parent strains (ST7 and ST8) . This suggests that similar recombination events may occur in htpX genes, potentially affecting protein function and virulence.

What is the role of HtpX in C. concisus virulence and pathogenesis mechanisms?

Protease HtpX is classified as a putative virulence protein in C. concisus, though its precise contribution to pathogenicity requires further elucidation. Mass spectrometry analysis has consistently identified HtpX among virulence-associated proteins expressed by C. concisus strains isolated from patients with inflammatory bowel disease .

Several mechanisms may explain HtpX's contribution to virulence:

  • Protein Quality Control: As a protease, HtpX likely participates in degrading misfolded or damaged membrane proteins, particularly under stress conditions encountered during host colonization.

  • Stress Response Regulation: HtpX may facilitate bacterial adaptation to varying oxygen levels, as evidenced by its expression under both anaerobic conditions with H₂ (8.44 ± 0.990 spectral counts) and without H₂ (10.5 ± 1.93 spectral counts) .

  • Host-Pathogen Interaction: HtpX might process bacterial surface proteins involved in adhesion, invasion, or immune evasion, similar to other bacterial proteases.

  • Coexpression Network: HtpX is expressed alongside other confirmed virulence factors including S-layer-RTX protein, fibronectin-binding protein, and hemagglutinin/hemolysin-related proteins, suggesting coordinated roles in pathogenesis .

The consistent expression of HtpX across different growth conditions indicates it may be fundamentally important for C. concisus biology beyond pathogenesis alone, making it a potential target for both understanding disease mechanisms and therapeutic intervention.

How does HtpX expression compare between oral and enteric C. concisus isolates from the same patient?

Comparative analysis of HtpX expression between oral and enteric C. concisus isolates from the same patient provides critical insights into bacterial adaptation during intestinal colonization. While specific data comparing HtpX expression levels between paired oral-enteric isolates is limited, related protein expression patterns can inform our understanding:

A significant finding was the disappearance of a 210 kD S-layer-RTX protein band in intestinal isolates compared to matched oral isolates . This protein contributes to bacterial pathogenesis through host cell adhesion and immune evasion functions . Given that HtpX is co-expressed with S-layer-RTX protein, it is reasonable to hypothesize that HtpX expression might similarly be modulated during intestinal adaptation.

Methodologically, researchers should:

  • Collect paired oral-enteric isolates from the same patient

  • Culture under identical conditions (anaerobic with/without H₂)

  • Compare protein expression using:

    • Quantitative proteomics with spectral counting

    • RT-qPCR for transcriptional analysis

    • Western blotting for protein-level validation

This approach would determine whether HtpX undergoes differential regulation during intestinal colonization, potentially contributing to site-specific adaptation and virulence.

What are the functional domains of HtpX and how can site-directed mutagenesis be used to study them?

HtpX protease in C. concisus (locus tag CCC13826_1039) contains several predicted functional domains that can be systematically investigated through site-directed mutagenesis:

  • Transmembrane Domains: As a membrane-bound protease, HtpX typically contains multiple transmembrane segments that anchor it to the bacterial membrane.

  • Zinc-Binding Motif: HtpX belongs to the zinc metalloprotease family, likely containing a conserved HEXXH motif essential for zinc coordination and catalytic activity.

  • PDZ-Like Domain: Many HtpX homologs contain a PDZ-like domain involved in substrate recognition and binding.

To investigate these domains using site-directed mutagenesis:

  • Target Selection:

    • Catalytic residues (H in HEXXH motif)

    • Zinc-coordinating residues

    • Transmembrane domain residues

    • Putative substrate-binding residues

  • Mutagenesis Strategy:

    • Generate alanine substitutions of key residues

    • Create domain deletion mutants

    • Construct chimeric proteins with domains from other proteases

  • Functional Characterization:

    • Assess proteolytic activity using synthetic peptide substrates

    • Determine membrane localization via fractionation

    • Evaluate protein stability through pulse-chase experiments

    • Measure virulence-associated phenotypes (adhesion, invasion, resistance)

  • In vivo Significance:

    • Complement C. concisus htpX knockout strains with mutant variants

    • Assess colonization efficiency in cell culture models

    • Evaluate contributions to stress resistance under anaerobic conditions with/without H₂

This systematic approach will reveal structure-function relationships of HtpX and potentially identify critical residues that could be targeted for inhibitor development.

What challenges are encountered when working with anaerobic C. concisus cultures, and how can they be addressed?

Working with C. concisus presents several technical challenges due to its fastidious growth requirements and sensitivity to environmental conditions:

  • Growth Rate and Viability Issues:

    • Challenge: Slow growth and variable viability across strains.

    • Solution: Optimize growth media with Horse Blood Agar (HBA) and incubation time (48-72 hours); use freshly prepared plates .

  • Atmospheric Condition Control:

    • Challenge: Maintaining precise H₂ concentrations in anaerobic environments.

    • Solution: Use commercial gas-generation systems with calibrated H₂ generation through controlled sodium borohydride reactions (NaBH₄ + 4H₂O = 4H₂ + NaB(OH)₄) .

  • Strain Variability:

    • Challenge: High genetic diversity between isolates affects experimental reproducibility.

    • Solution: Characterize strains through multilocus sequence typing and protein profiling before experiments; maintain reference strains with known characteristics .

  • Contamination Risks:

    • Challenge: Selective isolation is difficult when processing polymicrobial samples.

    • Solution: Use selective media supplements and filtration techniques; verify strain identity through PCR targeting C. concisus-specific sequences.

  • Protein Extraction Efficiency:

    • Challenge: Complete extraction of membrane-bound proteins like HtpX.

    • Solution: Optimize cell lysis using combination methods (sonication plus detergents); use subcellular fractionation to enrich for membrane proteins.

A systematic approach to these challenges ensures consistent results when working with C. concisus and studying proteins like HtpX under anaerobic conditions.

How can contradictory findings about HtpX expression between different studies be reconciled?

Contradictory findings about HtpX expression in C. concisus across different studies can be reconciled through careful methodological consideration and experimental design:

  • Standardization of Growth Conditions:

    • Discrepancies often arise from variations in culture conditions

    • Establish consensus protocols for:

      • Atmospheric composition (exact H₂ percentages)

      • Growth media formulations

      • Incubation times and temperatures

  • Strain Selection and Characterization:

    • C. concisus exhibits high genetic diversity; individuals are colonized with distinct strains

    • Create comprehensive strain collections with full genetic characterization

    • Report complete strain metadata including:

      • Isolation source (oral/enteric)

      • Patient disease status

      • Genetic typing results

  • Measurement Methodology Harmonization:

    • Compare spectral count data across studies using normalized approaches

    • Implement absolute quantification methods (targeted proteomics)

    • Validate protein expression with orthogonal techniques (Western blot, RT-qPCR)

  • Meta-analysis Framework:

    • Develop a standardized reporting format for HtpX expression data

    • Include raw data access in publications

    • Create centralized databases for C. concisus protein expression profiles

  • Context-Specific Interpretation:

    • Recognize that HtpX expression may vary based on:

      • Patient-specific factors

      • Disease stage

      • Co-colonizing microbiota

By implementing these approaches, researchers can better understand whether contradictions represent technical artifacts or true biological variability in HtpX expression patterns.

What techniques can be used to study HtpX protein-protein interactions in C. concisus?

Investigating HtpX protein-protein interactions in C. concisus requires specialized techniques that can capture both stable and transient interactions of this membrane-bound protease:

  • Co-Immunoprecipitation (Co-IP) with Membrane Adaptations:

    • Generate specific antibodies against HtpX or epitope-tag the protein

    • Use cross-linking agents to stabilize transient interactions

    • Optimize membrane protein solubilization using mild detergents (DDM, CHAPS)

    • Identify interacting proteins via mass spectrometry

  • Bacterial Two-Hybrid Systems:

    • Adapt split-ubiquitin or BACTH systems for membrane protein interactions

    • Create HtpX fusion constructs with reporter domains

    • Screen C. concisus genomic libraries for interaction partners

    • Validate interactions with targeted constructs

  • Proximity-Based Labeling:

    • Fuse HtpX to BioID or APEX2 enzymes

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins using streptavidin

    • Identify interaction partners through proteomics

  • Protein Correlation Profiling:

    • Analyze co-elution patterns of HtpX with other proteins during:

      • Size exclusion chromatography

      • Sucrose gradient centrifugation

      • Native electrophoresis

  • Computational Predictions and Validation:

    • Use algorithms to predict HtpX interaction partners based on:

      • Co-expression with other virulence factors (S-layer-RTX, fibronectin-binding protein)

      • Structural modeling of protein interfaces

      • Evolutionary conservation patterns

    • Validate top predictions experimentally

These techniques will help establish HtpX's protein interaction network, potentially revealing its role in virulence complexes and providing insights into its contribution to C. concisus pathogenesis.

How might understanding HtpX function contribute to novel therapeutic approaches for IBD?

Understanding HtpX function in C. concisus could lead to innovative therapeutic approaches for inflammatory bowel disease through several mechanistic pathways:

  • Targeted Anti-Virulence Strategies:

    • Developing specific HtpX inhibitors could reduce C. concisus virulence without affecting beneficial microbiota

    • Protease inhibitors could be delivered via oral formulations to reach intestinal sites of infection

    • Structure-based drug design targeting HtpX active sites would minimize off-target effects

  • Biomarker Development:

    • HtpX-specific antibodies could serve as diagnostic markers for C. concisus involvement in IBD

    • Monitoring HtpX levels in patient samples might predict disease flares or treatment response

    • Paired with other markers, HtpX could contribute to personalized treatment approaches

  • Vaccine Development Considerations:

    • If surface-exposed epitopes exist, HtpX could be included in multi-component vaccines

    • Understanding strain variation in HtpX would be crucial for broad-spectrum protection

    • Mucosal delivery systems could elicit local immunity at sites of C. concisus colonization

  • Pathway-Specific Interventions:

    • Identifying HtpX substrates might reveal indirect therapeutic targets

    • The protein's role in stress response suggests potential for combinatorial therapies that increase bacterial stress while inhibiting adaptation mechanisms

Given that C. concisus has been associated with IBD due to its significantly higher prevalence in intestinal tissues of IBD patients compared to controls , targeting HtpX represents a focused approach to addressing a potential microbial contributor to these inflammatory conditions.

What high-throughput screening methods can identify small molecule inhibitors of HtpX protease activity?

Identifying small molecule inhibitors of C. concisus HtpX protease activity can be accomplished through systematically designed high-throughput screening approaches:

  • Fluorescence-Based Protease Assays:

    • Develop FRET-based peptide substrates containing HtpX cleavage sites

    • Monitor fluorescence release upon substrate cleavage in 384/1536-well formats

    • Compounds inhibiting fluorescence signal indicate potential HtpX inhibitors

    • Adapt assay conditions to mimic anaerobic intestinal environment

  • Cell-Based Reporter Systems:

    • Engineer bacterial reporter strains expressing:

      • HtpX fused to split reporter proteins

      • Reporters activated by HtpX-dependent cleavage events

    • Measure luminescence/fluorescence changes in compound presence

    • Include counterscreens for cytotoxicity and non-specific effects

  • Fragment-Based Screening:

    • Use thermal shift assays to identify fragments binding to recombinant HtpX

    • Employ surface plasmon resonance for binding kinetics characterization

    • Conduct NMR-based fragment screening for structural insights

    • Merge or grow promising fragments for improved potency

  • In Silico Virtual Screening:

    • Generate homology models of HtpX based on related metalloprotease structures

    • Perform molecular docking of compound libraries against active site

    • Prioritize compounds based on predicted binding energy and interactions

    • Validate top virtual hits through biochemical assays

  • Repurposing Existing Protease Inhibitors:

    • Screen FDA-approved protease inhibitors against HtpX

    • Focus on zinc-dependent metalloprotease inhibitors

    • Optimize selective inhibition of bacterial versus human proteases

Promising hits should undergo secondary validation including:

  • Dose-response relationships

  • Selectivity profiling against other proteases

  • Effects on C. concisus growth and virulence in culture models

  • Stability under gastrointestinal conditions

This systematic approach can identify lead compounds for further medicinal chemistry optimization.

How does genetic variation in htpX across C. concisus strains correlate with clinical outcomes in IBD patients?

Investigating correlations between htpX genetic variation and clinical outcomes in IBD patients represents a frontier in understanding C. concisus pathogenicity. This complex question requires a multi-faceted research approach:

  • Comprehensive Strain Collection and Characterization:

    • Isolate C. concisus from multiple anatomical sites:

      • Oral samples (saliva, plaque)

      • Intestinal biopsies (inflamed and non-inflamed regions)

      • Fecal samples

    • Sequence htpX genes from all isolates

    • Perform whole-genome sequencing for broader genetic context

  • Variation Analysis Framework:

    • Identify single nucleotide polymorphisms (SNPs) in htpX coding regions

    • Detect structural variations (insertions, deletions, recombination events)

    • Analyze promoter regions for expression-altering polymorphisms

    • Catalog strain-specific variations and shared polymorphisms

  • Clinical Data Integration:

    • Collect detailed patient information:

      • Disease subtype (Crohn's disease vs. ulcerative colitis)

      • Disease location and behavior

      • Treatment response patterns

      • Disease progression metrics

    • Develop statistical models correlating genetic variations with clinical parameters

  • Functional Validation:

    • Express variant HtpX proteins recombinantly

    • Compare enzymatic activities of variants

    • Assess impact on protein-protein interactions

    • Evaluate effects on cellular phenotypes (adhesion, invasion, stress response)

  • Prospective Longitudinal Studies:

    • Track patients harboring different HtpX variants over time

    • Monitor disease flares and remission periods

    • Assess treatment response stratified by variant type

    • Determine whether variants predict disease course

This integrated approach would determine whether specific htpX variants serve as biomarkers for disease severity or treatment response, potentially enabling personalized therapeutic strategies for IBD patients colonized with C. concisus.

How does HtpX compare to other C. concisus virulence factors in terms of expression stability and functional importance?

Comparative analysis reveals that HtpX exhibits distinctive expression patterns relative to other C. concisus virulence factors, suggesting unique functional roles:

Virulence FactorExpression Level (Anaero H₂+)Expression Level (Anaero H₂−)Expression StabilityPutative Function
Protease HtpX8.44 ± 0.99010.5 ± 1.93HighProtein quality control, stress response
S-layer-RTX protein8.15 ± 3.744.00 ± 1.62ModerateCell surface structure, immune evasion
Fibronectin-binding protein12.8 ± 3.4312.8 ± 1.98Very HighHost cell adhesion, colonization
Hemagglutinin/hemolysin4.39 ± 1.772.33 ± 0.667LowCell toxicity, tissue damage
EvpB type VI secretion protein4.96 ± 0.5555.33 ± 0.722HighProtein secretion, bacterial competition

The data demonstrates that HtpX maintains relatively stable expression across anaerobic conditions regardless of H₂ presence , ranking among the more consistently expressed virulence factors. This expression stability suggests HtpX serves essential functions beyond pathogenesis alone, potentially in cellular homeostasis or stress adaptation.

The fibronectin-binding protein shows the highest expression stability, consistent with its critical role in host colonization . In contrast, S-layer-RTX protein and hemagglutinin/hemolysin demonstrate greater variability, suggesting more specialized or condition-dependent functions.

Notably, the absence of the S-layer-RTX protein has been observed in intestinal isolates compared to matched oral isolates from the same patient , while HtpX appears to be maintained across both environments, further emphasizing its fundamental importance to C. concisus biology.

What is the current consensus on the role of C. concisus in inflammatory bowel disease pathogenesis?

The current consensus regarding C. concisus in inflammatory bowel disease (IBD) pathogenesis reflects an evolving understanding of this bacterium as a potential contributor to intestinal inflammation:

  • Epidemiological Association:

    • C. concisus has been found at significantly higher prevalence in the intestinal tract of IBD patients compared to healthy controls

    • The bacterium is commonly isolated from both Crohn's disease and ulcerative colitis patients

    • Both oral and intestinal sites can harbor potentially pathogenic strains

  • Genetic Diversity and Pathogenicity:

    • Remarkable genetic diversity exists among C. concisus isolates

    • Patients may harbor multiple strains simultaneously, including recombinant variants

    • Not all strains appear equally pathogenic, suggesting strain-specific virulence factors

  • Virulence Mechanisms:

    • Expression of putative virulence proteins including proteases (HtpX), adhesins (fibronectin-binding protein), and toxins (hemagglutinin/hemolysin)

    • Adaptation to both anaerobic and microaerobic environments facilitates colonization of different intestinal niches

    • S-layer proteins may contribute to immune evasion but show variable expression between oral and intestinal isolates

  • Translocation Capability:

    • Genetic evidence shows that oral C. concisus strains can translocate to the intestinal tract

    • The same strain can adapt to different host environments through selective protein expression

  • Causality vs. Association:

    • Current evidence supports C. concisus as a potential pathobiont rather than a primary causative agent

    • The bacterium may opportunistically colonize the already-inflamed intestine or contribute to inflammation in susceptible hosts

    • Multiple factors likely influence whether colonization leads to disease

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.