Recombinant Campylobacter curvus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Biological Role in ATP Synthase

ATP synthase is a multisubunit complex comprising F1 (catalytic) and F0 (proton channel) sectors. Subunit a (atpB) in the F0 sector facilitates proton flow across the membrane, driving ATP synthesis via rotational catalysis . Key structural motifs include:

  • Transmembrane domains: Essential for proton translocation .

  • Conserved residues: M292, M571, and T88 (homologous to C. jejuni CmeB) linked to ion transport .

In Campylobacter, ATP synthase is vital for microaerobic survival, enabling adaptation to host gastrointestinal environments .

Expression and Purification

  • Host System: E. coli .

  • Tag: His tag for affinity chromatography .

  • Yield: Optimized via glycerol stabilization during reconstitution .

Research Applications

  • Antibiotic Resistance Studies: ATP synthase is a potential target for efflux pump inhibitors, as seen in C. jejuni CmeB .

  • Structural Biology: Used in crystallography to map proton channel dynamics .

  • Metabolic Studies: Investigating ATP dependency in Campylobacter’s microaerobic metabolism .

Genetic and Phylogenetic Insights

  • The atpB gene is conserved across Campylobacter species but shows phylum-specific variations in ATP synthase oligomerization .

  • In C. curvus, atpB clusters with C. jejuni and C. coli in multilocus sequence typing (MLST), suggesting lateral gene transfer events .

Future Research Directions

  • Drug Development: Targeting atpB to disrupt bacterial bioenergetics .

  • Comparative Genomics: Exploring ATP synthase evolution in Campylobacteriaceae .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
atpB; Ccur92_10600; CCV52592_0790; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Campylobacter curvus (strain 525.92)
Target Names
atpB
Target Protein Sequence
MKDLFLFSDLIYHNHLFVYAFHFCLVAIIVVLVAKLATSKMQLVPRGLQNIVEAYLEGVI SMGRDTLGSEALARKYLPLVATIGFVVFFSNAIGIIPGFESPTSSLNLTLTLALIVFFYY HFEGIKKNGFFKYFGHFMGPSKALAPLMFPVEIISHLSRIVSLSFRLFGNIKGDDLFLLV MLTLAPWFAPLPAYALLTLMAVLQTFIFMMLTYVYLAGAVAIEEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter curvus ATP synthase subunit a (atpB) and what is its role in bacterial physiology?

ATP synthase subunit a (atpB) is a critical component of the F₀ sector of the ATP synthase complex in Campylobacter curvus. This membrane-embedded protein forms part of the proton channel that couples the proton motive force (PMF) to ATP synthesis. The full-length protein consists of 225 amino acids in C. curvus and functions within the multisubunit ATP synthase complex to facilitate energy conversion processes. As a membrane protein, it contains hydrophobic regions that anchor it within the bacterial membrane, where it participates in the rotary mechanism that drives ATP synthesis through proton translocation across the membrane.

The protein is particularly important for energy metabolism in Campylobacter species, which as microaerophilic organisms must efficiently utilize available energy sources. ATP synthase operates by harnessing the proton gradient generated by respiratory complexes to synthesize ATP from ADP and inorganic phosphate, making atpB essential for bacterial energy production and survival in various environments.

How is recombinant C. curvus atpB typically expressed and purified for research applications?

The recombinant expression of C. curvus atpB typically employs E. coli as the host organism due to its well-established genetic tools and rapid growth. For optimal expression, the atpB gene (UniProt ID: A7GYS2) is generally fused to an N-terminal His-tag to facilitate purification and detection. The protein is expressed as a full-length construct spanning amino acids 1-225 of the native sequence.

The purification methodology typically follows these steps:

  • Expression in an appropriate E. coli strain under optimal induction conditions

  • Cell lysis using methods suitable for membrane proteins (e.g., sonication, French press)

  • Solubilization of membrane fractions using detergents like DDM or CHAPS

  • Affinity chromatography using Ni-NTA or similar matrices to capture the His-tagged protein

  • Size exclusion chromatography for further purification

  • Verification of purity by SDS-PAGE (should exceed 90%)

This approach yields recombinant protein suitable for structural and functional studies, although the membrane-associated nature of atpB presents challenges that may require optimization of solubilization and purification conditions.

What are the optimal storage conditions for maintaining recombinant C. curvus atpB stability and activity?

For long-term stability of recombinant C. curvus atpB, the following storage conditions are recommended:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, add 5-50% glycerol (final concentration) to prevent freeze damage

  • Aliquot the protein solution to minimize freeze-thaw cycles

  • For working solutions, store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity

When reconstituting the protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. The protein is typically stored in a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose, which helps maintain protein stability during freeze-thaw cycles. The presence of glycerol (typically 50% final concentration) further protects the protein structure during freezing.

What experimental approaches are recommended for studying the functional interaction of C. curvus atpB with other ATP synthase subunits?

To investigate functional interactions between C. curvus atpB and other ATP synthase subunits, several methodological approaches are recommended:

  • Co-expression and co-purification systems:

    • Design constructs for co-expression of atpB with interacting subunits

    • Implement dual affinity tags for sequential purification of intact complexes

    • Optimize detergent conditions to maintain native-like subunit interactions

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Apply chemical cross-linkers to stabilize transient interactions

    • Digest cross-linked complexes and analyze by LC-MS/MS

    • Use computational tools to map interaction interfaces from cross-linked peptides

  • FRET-based interaction assays:

    • Engineer fluorescent protein fusions to atpB and potential interaction partners

    • Measure energy transfer as indicator of molecular proximity

    • Conduct competition assays to validate specificity of interactions

  • Bacterial two-hybrid systems:

    • Adapt adenylate cyclase-based two-hybrid systems for membrane protein interactions

    • Screen for interactions between atpB and other ATP synthase components

    • Validate positive hits with alternative interaction assays

When studying membrane protein interactions like those involving atpB, it's critical to maintain a membrane-like environment using appropriate detergents or lipid nanodiscs to preserve native conformations and interaction capabilities.

How can researchers effectively use recombinant C. curvus atpB to identify potential inhibitors as antimicrobial agents?

Developing a robust screening platform for identifying atpB inhibitors requires systematic methodological approaches:

  • Establishment of functional assays:

    • Develop ATP synthesis assays using reconstituted proteoliposomes containing purified ATP synthase complex

    • Implement proton translocation assays using pH-sensitive fluorescent dyes

    • Design ATPase activity assays as a reverse reaction indicator

  • Structure-based virtual screening:

    • Generate homology models of C. curvus atpB based on related structures

    • Identify potential binding pockets using computational algorithms

    • Perform virtual screening of compound libraries against these pockets

    • Select candidates for experimental validation based on predicted binding energies

  • Fragment-based screening approaches:

    • Screen small molecular fragments for binding to purified atpB

    • Use thermal shift assays, surface plasmon resonance, or NMR to detect binding

    • Elaborate promising fragments into larger inhibitors

  • Validation in bacterial systems:

    • Test candidate inhibitors in C. curvus growth assays

    • Confirm target engagement using resistant mutants or overexpression studies

    • Evaluate specificity by testing against ATP synthases from different species

  • Assessing antimicrobial potential:

    • Determine minimum inhibitory concentrations (MICs)

    • Conduct time-kill studies to characterize bactericidal vs. bacteriostatic effects

    • Evaluate potential for resistance development through serial passage experiments

This systematic approach enables identification of atpB inhibitors that could serve as leads for novel antimicrobials against Campylobacter infections, which is particularly valuable given the emerging antibiotic resistance in these pathogens.

What are the optimal expression systems and conditions for producing functional recombinant C. curvus atpB?

The expression of functional recombinant C. curvus atpB requires careful consideration of expression systems and conditions to overcome challenges associated with membrane protein production:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coli BL21(DE3)High yield, simple genetics, rapid growthInclusion body formation, toxicityLower induction temperature (16-20°C), weak promoters, specialized strains (C41/C43)
E. coli Lemo21(DE3)Tunable expression, membrane protein-friendlyHigher complexityOptimization of L-rhamnose concentration for expression tuning
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesLower yields, higher costSupplementation with lipids/detergents, optimized extract preparation
Yeast systemsPost-translational modifications, eukaryotic machineryLonger growth times, different codon usageCodon optimization, selection of appropriate promoters

For C. curvus atpB specifically, E. coli expression systems have proven successful when the protein is fused to an N-terminal His tag. The expression protocol should include:

  • Induction at lower temperatures (16-20°C) to slow protein synthesis and facilitate proper folding

  • Use of specialized E. coli strains designed for membrane protein expression

  • Careful optimization of inducer concentration to prevent toxicity

  • Addition of membrane-stabilizing compounds (glycerol, specific lipids) to the culture medium

  • Extended expression times (overnight to 24 hours) at lower temperatures

The resulting protein can be purified to >90% purity using appropriate chromatographic techniques and verified by SDS-PAGE.

What analytical methods can effectively assess the structural integrity and functional activity of purified recombinant C. curvus atpB?

Multiple complementary analytical approaches are necessary to comprehensively characterize recombinant C. curvus atpB:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure composition

    • Limited proteolysis coupled with mass spectrometry to probe folding quality

    • Fluorescence spectroscopy to assess tertiary structure through intrinsic tryptophan fluorescence

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Functional activity assessment:

    • Proton translocation assays using reconstituted proteoliposomes and pH-sensitive dyes

    • ATP synthesis assays when incorporated into complete ATP synthase complexes

    • Binding assays with known ATP synthase inhibitors using isothermal titration calorimetry (ITC)

    • Hydrogen utilization assays in reconstituted systems, given the importance of hydrogen metabolism in Campylobacter species

  • Membrane integration analysis:

    • Proteoliposome reconstitution efficiency determination

    • Fluorescence quenching assays to assess membrane insertion

    • Electron microscopy of reconstituted systems to visualize membrane incorporation

  • Interaction studies:

    • Pull-down assays with other ATP synthase subunits

    • Native gel electrophoresis to assess complex formation

    • Surface plasmon resonance (SPR) to measure binding kinetics with interaction partners

These methodologies collectively provide a comprehensive assessment of both the structural integrity and functional capability of the purified recombinant protein, essential for ensuring reliable results in downstream applications.

How can researchers effectively design site-directed mutagenesis experiments to probe the functional mechanisms of C. curvus atpB?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in C. curvus atpB. A systematic experimental design should include:

  • Target selection based on structural and evolutionary analysis:

    • Identify conserved residues through multiple sequence alignment of atpB across bacterial species

    • Focus on residues in predicted proton channels or subunit interfaces

    • Consider residues with known functional importance in homologous proteins

    • The full amino acid sequence (MKDLFLFSDLIYHNHLFVYAFHFCLVAIIVVLVAKLATSKMQLVPRGLQNIVEAYLEGVISMGRDTLGSEALARKYLPLVATIGFVVFFSNAIGIIPGFESPTSSLNLTLTLALIVFFYYHFEGIKKNGFFKYFGHFMGPSKALAPLMFPVEIISHLSRIVSLSFRLFGNIKGDDLFLLVMLTLAPWFAPLPAYALLTLMAVLQTFIFMMLTYVYLAGAVAIEEH) provides a basis for selecting mutation targets

  • Mutation strategy development:

    • Design conservative mutations (similar physicochemical properties) to probe subtle functional effects

    • Create non-conservative mutations to dramatically alter local properties

    • Generate alanine-scanning mutations across functionally important regions

    • Introduce cysteine pairs for disulfide cross-linking to test proximity relationships

  • Functional characterization methodologies:

    • Compare wild-type and mutant proteins for proton translocation efficiency

    • Assess ATP synthesis rates in reconstituted systems

    • Measure binding affinities with other ATP synthase subunits

    • Determine structural changes using spectroscopic methods

    • Evaluate hydrogen utilization capacity, given the importance of hydrogen metabolism in related Campylobacter species

  • Experimental controls and validation:

    • Express and purify mutants alongside wild-type protein using identical conditions

    • Verify structural integrity of mutants using CD spectroscopy and thermal stability assays

    • Include positive and negative control mutations based on existing knowledge

    • Validate key findings with complementary approaches (e.g., complementation studies in bacteria)

This comprehensive approach enables researchers to systematically dissect the functional mechanisms of C. curvus atpB, contributing to our understanding of ATP synthase function and potentially identifying sites for therapeutic intervention.

How does the function of C. curvus atpB relate to bacterial hydrogen metabolism and pathogenesis?

The relationship between C. curvus atpB and bacterial hydrogen metabolism represents an emerging area of research with significant implications for understanding pathogenesis:

Campylobacter species, including C. jejuni and C. concisus, utilize hydrogen as an energy source in the gastrointestinal environment. This molecular hydrogen (H₂) is abundantly produced by colonic microbiota at concentrations of approximately 168 μM in the small intestine and 43 μM in the stomach, far exceeding the apparent affinities of most pathogens for H₂ (1.8 to 2.5 μM).

The ATP synthase complex, of which atpB is a critical component, plays a central role in this energy harvesting system. The process operates as follows:

  • Hydrogenase enzymes cleave H₂ into electrons and protons

  • The derived protons contribute to the proton motive force (PMF)

  • Electrons enter aerobic or anaerobic respiratory chains

  • The resulting PMF drives ATP synthesis via the ATP synthase complex containing atpB

Research has demonstrated that hydrogen metabolism is critical for growth and virulence in several gastrointestinal pathogens, including C. jejuni. The regulatory mechanisms controlling ATP synthase expression are complex, with various signals and regulators affecting hydrogenase operon expression, including:

  • Redox state (regulated by factors such as ArcA)

  • Oxygen levels (regulated by factors such as FNR)

  • Energy availability (regulated by factors such as CRP)

  • Metal availability (regulated by factors such as Fur and NikR)

For C. curvus specifically, the atpB component of ATP synthase likely plays a crucial role in harnessing the energy derived from hydrogen metabolism, contributing to the organism's ability to colonize the gastrointestinal tract and potentially to its pathogenicity. This connection between hydrogen metabolism, ATP synthesis, and pathogenesis represents an important area for further investigation.

What comparative analyses can reveal about C. curvus atpB evolution and potential functional adaptations?

Comparative analyses of C. curvus atpB can provide valuable insights into its evolution and functional adaptations through several methodological approaches:

  • Phylogenetic analysis across Campylobacter species:

    • Construct maximum-likelihood phylogenetic trees using atpB sequences

    • Identify clades with accelerated evolutionary rates

    • Map evolutionary relationships against known pathogenicity patterns

    • Compare evolutionary rates of atpB versus other ATP synthase subunits

  • Selection pressure analysis:

    • Calculate dN/dS ratios across the protein sequence

    • Identify sites under positive selection that may indicate functional adaptation

    • Compare selection patterns between pathogenic and non-pathogenic Campylobacter species

    • Correlate selection patterns with predicted functional domains

  • Structural homology modeling and comparison:

    • Generate structural models based on homologous proteins with known structures

    • Compare predicted structures across Campylobacter species

    • Identify conserved structural elements versus variable regions

    • Map conservation patterns onto functional domains (e.g., proton channel, subunit interfaces)

  • Functional domain analysis in the context of hydrogen metabolism:

    • Compare atpB sequences from hydrogen-utilizing versus non-utilizing bacteria

    • Identify potential adaptations in proton channeling regions

    • Examine variations in regions interacting with other ATP synthase subunits

    • Analyze potential co-evolution with hydrogenase components

Such comprehensive comparative analyses can reveal how C. curvus atpB has adapted to specific environmental niches, potentially contributing to pathogenicity, and may identify regions of the protein that could serve as targets for species-specific inhibitors.

What methods are most effective for studying C. curvus atpB in the context of the complete ATP synthase complex?

Investigating C. curvus atpB within the full ATP synthase complex requires specialized methodological approaches:

  • Co-expression and purification strategies:

    • Design polycistronic expression systems encoding multiple ATP synthase subunits

    • Implement dual affinity tags for sequential purification of intact complexes

    • Optimize detergent and lipid conditions to maintain complex integrity

    • Consider cell-free expression systems for direct incorporation into liposomes

  • Structural characterization of the complex:

    • Cryo-electron microscopy for high-resolution structural determination

    • Cross-linking mass spectrometry to map subunit interfaces

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamics and accessibility

    • Single-particle analysis to capture different conformational states

  • Functional reconstitution systems:

    • Proteoliposome reconstitution with purified ATP synthase complexes

    • Establishment of proton gradients using ionophores or light-driven pumps

    • Real-time monitoring of ATP synthesis and proton translocation

    • Patch-clamp studies to measure proton conductance through F₀ complexes

  • In vivo analysis approaches:

    • Generation of complementation systems in ATP synthase-deficient strains

    • Construction of chimeric ATP synthases to test subunit compatibility

    • Site-specific incorporation of fluorescent probes for FRET studies

    • Hydrogen utilization assays in intact cells, given the connection between hydrogen metabolism and ATP synthesis in Campylobacter species

  • Regulatory analysis:

    • Investigation of transcriptional regulation under different growth conditions

    • Analysis of post-translational modifications affecting complex assembly or function

    • Study of protein-protein interactions using bacterial two-hybrid or split-GFP systems

    • Examination of expression patterns during infection models

These approaches collectively provide a comprehensive toolkit for studying C. curvus atpB within its native complex, essential for understanding its true physiological function and potential as an antimicrobial target.

What are the current challenges in expressing and purifying sufficient quantities of functional C. curvus atpB for structural studies?

Researchers face several significant challenges when attempting to produce recombinant C. curvus atpB in quantities and quality suitable for structural studies:

  • Membrane protein expression limitations:

    • Low expression levels compared to soluble proteins

    • Toxicity to host cells when overexpressed

    • Misfolding and aggregation in heterologous systems

    • Challenges in scaling up production

  • Purification and stability challenges:

    • Requirement for detergents that may destabilize the protein

    • Loss of native lipid interactions that stabilize structure

    • Limited stability after extraction from membranes

    • Difficulty maintaining functional state during concentration

  • Methodological approaches to overcome these challenges:

    • Implementation of specialized E. coli strains (C41/C43, Lemo21)

    • Use of fusion partners (MBP, SUMO) to enhance solubility

    • Screening of expression conditions (temperature, induction time, media composition)

    • Testing of multiple detergents and lipid supplements during purification

    • Addition of stabilizers (glycerol, specific lipids, trehalose) to buffers

  • Advanced expression systems to consider:

    • Cell-free systems supplemented with lipids or nanodiscs

    • Specialized yeast strains optimized for membrane protein expression

    • Baculovirus-insect cell systems for eukaryotic processing machinery

    • Nanodiscs or SMALPs (styrene-maleic acid lipid particles) to maintain native-like environment

The development of effective expression and purification protocols for C. curvus atpB represents a crucial foundation for structural and functional studies that can inform our understanding of ATP synthase function and potential therapeutic interventions in Campylobacter infections.

How can researchers effectively correlate in vitro findings about C. curvus atpB with its role in bacterial physiology and pathogenesis?

Bridging the gap between in vitro biochemical studies and in vivo relevance requires multidisciplinary approaches:

  • Genetic manipulation strategies:

    • Construction of atpB knockout and complementation systems

    • Development of conditional expression systems to control atpB levels

    • Creation of site-directed mutants based on in vitro findings

    • Implementation of chromosomal tags for tracking protein localization

  • Infection model systems:

    • Establishment of cell culture models for Campylobacter infection

    • Development of animal models that recapitulate human infection

    • Ex vivo organ culture systems to study tissue-specific effects

    • Microfluidic devices to simulate host microenvironments

  • Physiological assessment methodologies:

    • Real-time measurement of ATP levels in live bacteria

    • Determination of membrane potential in wild-type versus atpB-modified strains

    • Analysis of growth rates under various energy source conditions

    • Assessment of hydrogen utilization capacity in relation to ATP synthesis

  • Integrative analytical approaches:

    • Transcriptomic analysis to identify gene expression networks affected by atpB function

    • Metabolomic profiling to assess metabolic shifts in atpB mutants

    • Proteomics to identify interaction partners and post-translational modifications

    • Systems biology modeling to integrate biochemical and physiological data

  • Correlation with clinical observations:

    • Analysis of atpB sequence variations in clinical isolates

    • Assessment of ATP synthase activity in strains with different virulence profiles

    • Investigation of atpB expression during different stages of infection

    • Examination of host immune responses to ATP synthase components

These approaches collectively enable researchers to connect molecular findings about C. curvus atpB structure and function with its broader role in bacterial physiology and pathogenesis, potentially identifying new therapeutic strategies for Campylobacter infections.

What emerging technologies might advance our understanding of C. curvus atpB function and its potential as a therapeutic target?

Several cutting-edge technologies hold promise for deepening our understanding of C. curvus atpB:

  • Advanced structural biology techniques:

    • Cryo-electron tomography for visualizing ATP synthase in native membranes

    • Micro-electron diffraction (microED) for structural determination from small crystals

    • Integrative structural biology combining multiple data sources (SAXS, NMR, XL-MS)

    • Time-resolved structural methods to capture dynamic conformational changes

  • Single-molecule approaches:

    • High-speed atomic force microscopy to visualize ATP synthase rotation

    • Single-molecule FRET to track conformational dynamics

    • Optical tweezers to measure force generation by the ATP synthase complex

    • Nanopore recording of proton translocation through individual channels

  • Advanced genetic technologies:

    • CRISPR interference for precise regulation of atpB expression

    • In vivo mutagenesis libraries to probe function comprehensively

    • Proximity labeling approaches to map protein interaction networks

    • Synthetic biology approaches to create minimal ATP synthase systems

  • Computational advances:

    • Molecular dynamics simulations of atpB in membrane environments

    • Quantum mechanics/molecular mechanics (QM/MM) modeling of proton translocation

    • Deep learning approaches for structure prediction and functional annotation

    • Network analysis of hydrogen metabolism in relation to ATP synthesis

  • Drug discovery technologies:

    • Fragment-based drug discovery using NMR or crystallography

    • DNA-encoded libraries for high-throughput screening

    • Structure-based virtual screening against multiple conformational states

    • Activity-based protein profiling to identify selective inhibitors

These emerging technologies, applied individually or in combination, have the potential to significantly advance our understanding of C. curvus atpB structure, function, and its role in bacterial pathogenesis, ultimately informing the development of novel therapeutic strategies targeting ATP synthase in Campylobacter infections.

Based on current knowledge, what are the most promising research directions for C. curvus atpB studies?

The current state of knowledge about C. curvus atpB suggests several high-priority research directions that could significantly advance the field:

  • Structure-function relationship studies:

    • Determination of high-resolution structures of C. curvus atpB in different conformational states

    • Mapping of the proton translocation pathway through the membrane domain

    • Investigation of subunit interactions within the ATP synthase complex

    • Correlation of structural features with energy coupling efficiency

  • Pathogenesis and virulence connections:

    • Exploration of the link between ATP synthase function and Campylobacter pathogenicity

    • Investigation of atpB expression regulation during different stages of infection

    • Analysis of the relationship between hydrogen metabolism and ATP synthase activity

    • Assessment of host immune responses to ATP synthase components

  • Therapeutic targeting approaches:

    • Design of specific inhibitors targeting unique features of C. curvus atpB

    • Development of combination therapies targeting energy metabolism pathways

    • Investigation of natural products with activity against ATP synthase

    • Exploration of atpB as a potential vaccine antigen

  • Evolutionary and comparative studies:

    • Comparative analysis of atpB across Campylobacter species with different pathogenicity profiles

    • Investigation of horizontal gene transfer and recombination events in atpB evolution

    • Study of co-evolution patterns between atpB and other ATP synthase subunits

    • Examination of selection pressures on atpB in different ecological niches

These research directions hold particular promise for advancing our understanding of C. curvus biology and potentially developing new strategies for combating Campylobacter infections.

What methodological recommendations can improve research reproducibility when working with recombinant C. curvus atpB?

To enhance research reproducibility when working with this challenging membrane protein, researchers should consider implementing these methodological recommendations:

  • Standardized expression and purification protocols:

    • Document detailed protocols including strain genotypes, plasmid maps, and expression conditions

    • Specify exact buffer compositions, including detergent types, concentrations, and critical micelle concentrations

    • Report protein yields at each purification step with representative gel images

    • Validate protein identity through mass spectrometry and N-terminal sequencing

  • Comprehensive quality control measures:

    • Implement multiple purity assessment methods beyond SDS-PAGE (e.g., SEC-MALS, dynamic light scattering)

    • Verify protein folding through circular dichroism and fluorescence spectroscopy

    • Assess oligomeric state using analytical ultracentrifugation or native PAGE

    • Conduct functional assays to confirm biological activity of purified protein

  • Detailed reporting of experimental conditions:

    • Specify temperature, pH, buffer composition, and ionic strength for all experiments

    • Document protein concentration determination methods and standards used

    • Report storage conditions and demonstrate stability over the experimental timeframe

    • Include positive and negative controls in all functional assays

  • Data management and sharing practices:

    • Deposit sequence data in public databases with appropriate annotation

    • Share raw data through repositories like Zenodo or figshare

    • Provide detailed supplementary methods sections in publications

    • Consider pre-registration of experimental designs for key studies

Adherence to these recommendations will significantly enhance the reproducibility of research involving recombinant C. curvus atpB, accelerating scientific progress and facilitating more effective collaboration across research groups.

How might findings from C. curvus atpB research translate to broader applications in microbiology and medicine?

Research on C. curvus atpB has the potential to impact several broader scientific and medical fields:

  • Antimicrobial development:

    • Identification of novel binding sites for ATP synthase inhibitors

    • Development of narrow-spectrum antibiotics targeting Campylobacter-specific features

    • Creation of combination therapies targeting energy metabolism pathways

    • Design of anti-virulence strategies that disrupt ATP synthase function without killing bacteria

  • Fundamental bioenergetics research:

    • Deeper understanding of proton translocation mechanisms

    • Insights into the evolution of ATP synthases across diverse bacteria

    • Clarification of structure-function relationships in membrane protein complexes

    • Elucidation of regulatory mechanisms controlling energy metabolism

  • Microbiome science applications:

    • Understanding how energy metabolism influences bacterial community dynamics

    • Insights into hydrogen economy within the gut microbiome

    • Development of approaches to selectively target pathogenic Campylobacter while sparing beneficial microbiota

    • Potential prebiotic or probiotic strategies to modulate hydrogen availability

  • Biotechnological applications:

    • Engineering of ATP synthase components for enhanced efficiency in biotechnological processes

    • Development of biosensors based on ATP synthase components

    • Creation of minimal ATP synthase systems for synthetic biology applications

    • Potential applications in biofuel cell development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.