Recombinant Campylobacter curvus ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Overview of ATP Synthase Subunit c (atpE)

ATP synthase is a membrane-bound enzyme responsible for converting proton gradients into ATP. In Campylobacter curvus, the enzyme comprises two main sectors:

  • F₀: A membrane-embedded complex containing subunits a, b, b', and c (atpE), which facilitates proton translocation.

  • F₁: A soluble catalytic complex (α₃β₃γδε) that synthesizes ATP .

Subunit c (atpE) forms a rotating c-ring critical for coupling proton movement to ATP synthesis. This subunit is evolutionarily conserved across bacterial species and is essential for the enzyme’s mechanical rotation .

Recombinant C. curvus atpE: Production and Characteristics

The recombinant atpE protein is produced via heterologous expression in E. coli and purified using affinity chromatography due to its N-terminal His-tag. Key specifications include:

ParameterDetails
AccessionA7GX83 (UniProt entry)
LengthFull-length (1–100 amino acids)
TagN-terminal His-tag (6xHis)
Purity>90% (verified via SDS-PAGE)
SourceE. coli (recombinant expression)
StorageLyophilized powder; store at -20°C or -80°C

Role in Proton Translocation

Subunit c forms a c-ring structure that rotates as protons traverse the membrane. This rotation drives conformational changes in the F₁ sector, enabling ATP synthesis . In C. curvus, the c-ring’s composition (e.g., number of c-subunits) and interactions with subunit a determine proton transport efficiency .

Vaccine Development

While not explicitly stated in available data, ATP synthase subunits are often explored as vaccine candidates due to their surface localization. For example, C. curvus enolase (eno) and ATP synthase subunit β (atpD) are under investigation for vaccine applications . Subunit c could similarly serve as an antigenic target.

Biochemical Assays

  • SDS-PAGE: Quality control of purified protein .

  • Protein-Protein Interactions: Studying binding with subunits a, b, or b’ to reconstitute functional F₀ complexes .

Subunit c in C. curvus vs. Other Species

SpeciesSubunit c LengthKey Features
C. curvus100 aaHis-tagged, expressed in E. coli
Bacillus caldotenax72 aaShorter isoform, identical mature sequence
MitochondriaVariable (P1/P2/P3)Isoforms differ in targeting peptides

Functional Non-Redundancy

In eukaryotic mitochondria, subunit c isoforms (e.g., P1, P2, P3) are non-redundant due to distinct targeting peptides, which influence respiratory chain assembly . While analogous studies in C. curvus are lacking, this suggests subunit c may have specialized roles in bacterial ATP synthase regulation.

Relevant Subunits in C. curvus ATP Synthase

SubunitGeneFunction
c (atpE)atpEProton translocation, c-ring formation
a (atpB)atpBProton channel, F₀-F₁ interaction
β (atpD)atpDCatalytic subunit (F₁ sector)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpE; Ccur92_05210; CCV52592_0957; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Campylobacter curvus (strain 525.92)
Target Names
atpE
Target Protein Sequence
MKKIVLLIVSLAAFAFGADGEMIRSYSVIAAGIGLGLAALGGAIGMGNTAAATISGTARN PGVGSKLMTTMFIALAMIEAQVIYALVITLIVLYANPMLG
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase generates ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled through a rotary mechanism of the central stalk subunits to proton translocation.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Campylobacter curvus ATP synthase subunit c (atpE)?

Recombinant Campylobacter curvus ATP synthase subunit c (atpE) is a protein component of the c-ring structure within the F0 portion of ATP synthase, expressed through recombinant technology. The c-ring forms a critical part of the rotor assembly in bacterial ATP synthase and contains the proton-binding sites essential for energy conversion. Similar to other Campylobacter species, C. curvus atpE is part of the ATP synthase complex that couples the proton-motive force across the bacterial membrane to ATP synthesis. As a recombinant protein, it is typically produced in heterologous expression systems for research applications in structural biology, enzyme characterization, and antimicrobial development .

  • How is ATP synthase subunit c involved in energy production in Campylobacter species?

ATP synthase subunit c functions as a critical component in the energy production pathway of Campylobacter species. In ATP synthase, the c-ring contains H+-binding sites that facilitate proton translocation across the bacterial membrane. This proton movement drives the rotation of the c-ring, which is mechanically coupled to the central stalk of the F1 catalytic domain, ultimately leading to ATP synthesis.

In Campylobacter species, this energy production mechanism is essential for survival and pathogenicity. Studies examining ATP contents of different Campylobacter morphologies have demonstrated that ATP levels correlate with viability and metabolic activity. For instance, filamentous forms of Campylobacter jejuni have been shown to contain significantly higher ATP levels (up to 17.4 fg ATP/CFU in strain 12661) compared to spiral forms (approximately 1-2 fg ATP/CFU), while coccoid forms show extremely low or undetectable ATP levels, suggesting they are metabolically inactive or non-viable .

  • What expression systems are commonly used to produce recombinant Campylobacter ATP synthase proteins?

Multiple expression systems can be employed for the recombinant production of Campylobacter ATP synthase proteins, with selection dependent on research objectives:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, rapid growth, well-established protocolsPotential improper folding, lack of post-translational modificationsStructural studies, antibody production
YeastEukaryotic post-translational modifications, high yieldLonger culture time than E. coliFunctional studies requiring modifications
BaculovirusComplex eukaryotic modifications, proper foldingTechnical complexity, lower yieldHigh-quality structural analysis
Mammalian CellNative-like folding and modificationsHighest cost, lowest yieldStudies requiring authentic protein structure

For Campylobacter proteins specifically, E. coli expression systems have been successfully employed for ATP synthase components, as evidenced by the development of whole-operon expression plasmids for Pseudomonas aeruginosa ATP synthase in E. coli, which facilitates structure-function studies that could be adapted for Campylobacter ATP synthase research . The choice of expression system should be guided by the specific requirements of the downstream applications, such as structural analysis, functional studies, or inhibitor screening .

  • What structural features distinguish the ATP synthase c-ring in Campylobacter from other bacterial species?

The ATP synthase c-ring in Campylobacter possesses distinct structural features compared to other bacterial species, particularly in the H+-binding region. While specific structural data for C. curvus is limited, insights can be drawn from related bacterial ATP synthases:

The c-subunit's H+-binding site in Campylobacter likely contains specific amino acid residues that determine proton affinity and inhibitor binding properties. Comparative analysis with other gram-negative bacteria suggests that Campylobacter ATP synthase c-rings may have unique features in their proton-binding sites. For example, in Pseudomonas aeruginosa, the c-subunit's binding site is less sterically hindered and more hydrophobic compared to Mycobacterium tuberculosis, with key substitutions including Asp→Phe27, Tyr→Thr63, Phe→Met64, and Leu→Val67 .

These structural differences significantly impact inhibitor binding efficacy and specificity, which has direct implications for antimicrobial development targeting Campylobacter ATP synthase.

Advanced Research Questions

  • What methodologies are most effective for assessing inhibition of Campylobacter ATP synthase activity?

The evaluation of inhibitors targeting Campylobacter ATP synthase requires robust methodological approaches. Based on established protocols for related bacterial ATP synthases, the following methods are recommended:

In vitro ATP synthesis assay using inverted membrane vesicles:

  • Prepare inverted membrane vesicles from Campylobacter cultures by differential centrifugation and disruption techniques.

  • Measure NADH-driven ATP synthesis using a luciferin/luciferase-based luminescence assay.

  • Determine IC50 values by testing inhibitor compounds at increasing concentrations (typically 0.1-100 μg/mL).

  • Apply a dose-response model to calculate accurate IC50 values.

This approach has been successfully employed with ATP synthase inhibitors in Pseudomonas aeruginosa, where compounds targeting the c-ring showed IC50 values ranging from 0.7 to 11.1 μg/mL .

Mutational analysis to confirm binding sites:

  • Introduce site-directed mutations in the atpE gene using synthetic gene fragments.

  • Express the mutant ATP synthase in a suitable host system.

  • Prepare membrane vesicles from mutant strains and wild-type controls.

  • Compare inhibition profiles between mutant and wild-type ATP synthases.

This approach can provide strong evidence for the binding site of inhibitors, as demonstrated by the altered inhibition profiles of quinoline compounds against P. aeruginosa ATP synthase with mutations at Ile65 in the c-subunit .

  • How can site-directed mutagenesis be leveraged to study the H+ binding site in ATP synthase subunit c?

Site-directed mutagenesis provides a powerful approach to investigate the H+ binding site in ATP synthase subunit c, offering insights into both function and inhibitor interactions:

Methodological approach:

  • Identify conserved and variant residues in the c-subunit H+ binding region through sequence alignment of Campylobacter ATP synthase with well-characterized bacterial homologs.

  • Design mutations targeting:

    • The essential acidic residue involved in H+ binding

    • Neighboring residues that may affect inhibitor binding

    • Residues that differ between Campylobacter and other bacterial species

  • Introduce mutations to the atpE gene in an expression plasmid using PCR-based site-directed mutagenesis or synthetic gene fragments.

  • Express wild-type and mutant proteins in a suitable host system.

  • Evaluate functional consequences using:

    • ATP synthesis assays with inverted membrane vesicles

    • Inhibitor binding studies with various ATP synthase inhibitors

Key considerations based on previous research:

  • Mutations near the H+ binding site can significantly alter inhibitor efficacy without abolishing ATP synthesis function, as demonstrated with Ile65Ala and Ile65Phe mutations in P. aeruginosa ATP synthase.

  • The Ile65Phe mutation increased the potency of compound 4 (a quinoline derivative) by more than 6-fold, likely by enhancing π-stacking interactions.

  • Conversely, the Ile65Ala mutation decreased the potency of compound 5, potentially by reducing van der Waals interactions .

This mutational approach can reveal the specific binding mode of inhibitors and provide insights into the structural determinants of c-ring function in Campylobacter ATP synthase.

  • What are the optimal methods for measuring ATP content in different morphological forms of Campylobacter?

Accurate measurement of ATP content in different morphological forms of Campylobacter requires specialized techniques to separate and analyze distinct cell populations:

Recommended methodology:

  • Culture preparation and morphotype separation:

    • Culture Campylobacter in appropriate media (e.g., MEM with sodium pyruvate) under microaerobic conditions at 37°C.

    • Monitor growth phases through viable counting and microscopic examination.

    • Harvest cells at specific time points corresponding to different morphological states:

      • Exponential phase (12-14h): predominantly spiral forms

      • Decline phase (96h): mixture of spiral and filamentous forms

      • Late decline phase (>168h): predominantly coccoid forms

    • Separate morphotypes through differential centrifugation or filtration techniques.

  • ATP quantification:

    • Lyse cells using an appropriate buffer system.

    • Determine ATP content using a luciferase/luciferin luminescence assay.

    • Calculate ATP content per CFU by correlating luminescence readings with viable counts.

    • For mixed populations, correct for the proportion of each morphotype.

Expected findings based on C. jejuni research:

  • Spiral cells in exponential phase typically contain 0.99-1.7 fg ATP per CFU.

  • Filamentous forms may contain significantly higher ATP levels (2.66-17.4 fg ATP per CFU), with longer filaments correlating with higher ATP content.

  • Coccoid forms generally show extremely low or undetectable ATP levels, suggesting metabolic inactivity .

This methodology enables precise characterization of the metabolic state of different Campylobacter morphologies, providing insights into survival strategies and potential antimicrobial targets.

  • What approaches can be used to investigate the stoichiometry and assembly of the c-ring in Campylobacter ATP synthase?

Investigating the c-ring stoichiometry and assembly in Campylobacter ATP synthase requires a multi-faceted approach combining structural, biochemical, and genetic techniques:

Structural determination methods:

  • Cryo-electron microscopy (cryo-EM):

    • Purify intact ATP synthase or isolated c-rings using detergent solubilization and chromatography.

    • Prepare samples for cryo-EM using appropriate grid preparation protocols.

    • Collect high-resolution images and perform single-particle analysis.

    • Determine the number of c-subunits by analyzing symmetry and structural features.

  • Cross-linking mass spectrometry:

    • Apply chemical cross-linkers to stabilize c-ring structure.

    • Digest cross-linked complexes and analyze by mass spectrometry.

    • Identify cross-linked peptides to map spatial relationships between subunits.

    • Determine stoichiometry from the pattern of cross-links.

Functional approaches:

  • Site-specific labeling and quantification:

    • Introduce unique labeling sites in the c-subunit.

    • Quantify the ratio of labeled sites to ATP synthase complexes.

    • Calculate stoichiometry based on labeling efficiency.

  • Genetic manipulation:

    • Create fusion constructs with defined numbers of covalently linked c-subunits.

    • Express these constructs and assess functionality.

    • Determine the minimum number of subunits required for function.

Based on related bacterial systems, Campylobacter ATP synthase c-rings likely contain 10-15 c-subunits, with the exact number potentially influencing bioenergetic properties and inhibitor binding. As observed in Acinetobacter baumannii, c-rings typically have a defined stoichiometry with multiple potential binding sites for inhibitors around the ring .

  • How do inhibitors targeting ATP synthase subunit c exert their antimicrobial effects against Campylobacter?

Inhibitors targeting ATP synthase subunit c exert antimicrobial effects against Campylobacter through multiple mechanisms that disrupt energy metabolism:

Primary mechanism of action:

  • Disruption of proton translocation:

    • Inhibitors bind to the H+ binding sites on the c-ring, blocking the proton channel.

    • This prevents proton flow through the F0 domain, disrupting the proton-motive force.

    • Without proton translocation, c-ring rotation is inhibited, halting ATP synthesis.

  • Impact on cellular bioenergetics:

    • ATP depletion leads to energy starvation in bacterial cells.

    • Disruption of the proton gradient affects other membrane-dependent processes.

    • Metabolic collapse ultimately results in cell death.

Structure-activity relationships of inhibitors:
Based on studies with quinoline derivatives targeting ATP synthase in P. aeruginosa, effective inhibitors typically share these structural features:

  • A hydrophobic core structure (e.g., quinoline) that interacts with the c-ring.

  • Specific substituents that enhance binding to the H+ binding site region.

  • Structural elements that promote interaction with specific residues in the c-subunit.

For example, compounds with a C1 methyl sulfide and a bulky, hydrophobic group at C2 show enhanced inhibitory effects, with IC50 values as low as 0.7 μg/mL for compound 5 against P. aeruginosa ATP synthase .

Challenges in Campylobacter inhibition:

  • Bacterial efflux systems may reduce inhibitor effectiveness by pumping compounds out of the cell.

  • Differences in c-ring structure between bacterial species affect inhibitor binding affinity.

  • The outer membrane of gram-negative bacteria like Campylobacter presents a permeability barrier for some inhibitors.

These insights provide a foundation for developing targeted antimicrobials against Campylobacter ATP synthase, potentially addressing the growing concern of antimicrobial resistance in this pathogen.

  • What correlation exists between ATP synthase activity and morphological transitions in Campylobacter species?

The relationship between ATP synthase activity and morphological transitions in Campylobacter species reveals important insights into bacterial adaptation strategies:

ATP content across morphological states:
Research with C. jejuni has demonstrated significant variations in ATP content across different cell morphologies:

Morphological FormATP Content (fg/CFU)Growth PhaseViability
Spiral (exponential)0.99-1.7Exponential (14h)High
Spiral (decline)Lower than exponentialDecline (96h)Reduced
Filamentous2.66-17.4Decline (96h)Maintained
CoccoidExtremely low/undetectableLate decline (>168h)Very low/non-viable

Physiological significance:

  • Filamentation as a survival strategy:

    • Filamentous forms appear during nutrient limitation and stress conditions.

    • The higher ATP content in filaments (up to 17.4 fg ATP/CFU in C. jejuni 12661) suggests they maintain metabolic activity during adverse conditions.

    • Filament length correlates with ATP content, with longer filaments showing higher energy reserves.

  • Transition to coccoid form:

    • The transformation to coccoid morphology occurs in late decline phase (>168h).

    • Coccoid forms show extremely low or undetectable ATP levels, indicating they are metabolically inactive or non-viable.

    • This transformation may represent a degenerative process rather than an active adaptation strategy.

  • Metabolic activity and viability:

    • The ATP content serves as a reliable indicator of metabolic activity and potential viability.

    • Cultures transitioning to predominantly coccoid forms (58-61% in C. jejuni PT14 and 12661 at 216h) maintain a small subpopulation of viable cells, likely representing remaining spiral and filamentous forms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.