Recombinant Campylobacter curvus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Ccur92_06200; CCV52592_0437; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Campylobacter curvus (strain 525.92)
Target Names
mscL
Target Protein Sequence
MSFIGEFKEFAMKGNVLDMAVGVVIGTAFGKIVSSLVGDIIMPIVGVITGGVNFTDLKIT LKDAAQGVPAVTINYGNFIQTAVDFLIIAFCIFCVIKAINSLKRKPAEPEVAQPAAPAED IVLLTQIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter curvus and why would its MscL channel be of research interest?

Campylobacter curvus is a Gram-negative bacterium primarily associated with periodontal disease in humans, though it has also been implicated in cases of bloody gastroenteritis and chronic diarrhea. It belongs to the Campylobacter genus, which includes several species of clinical significance . C. curvus is particularly challenging to identify using conventional microbiological techniques, often requiring molecular methods such as 16S rRNA sequencing or MALDI-TOF mass spectrometry for accurate identification .

The large-conductance mechanosensitive channel (MscL) found in bacteria like C. curvus represents one of the largest pores in nature, with a diameter exceeding 25 Å. These channels gate in response to increased membrane tension and play crucial roles in osmotic regulation . The study of C. curvus MscL would be valuable for several reasons:

  • Understanding bacterial survival mechanisms during osmotic stress

  • Exploring unique structural or functional adaptations of MscL in a relatively understudied pathogen

  • Investigating potential applications in controlled molecular delivery systems

  • Examining evolutionary conservation of mechanosensitive channels across bacterial species

What are the recommended expression systems for recombinant C. curvus MscL?

For recombinant expression of C. curvus MscL, several expression systems can be considered based on established protocols for other bacterial MscL proteins:

Bacterial expression systems remain the preferred choice for MscL production due to their simplicity and cost-effectiveness. E. coli expression systems using vectors with inducible promoters (such as T7 or arabinose-inducible systems) typically yield sufficient protein for most applications. The BL21(DE3) strain or its derivatives are recommended to minimize proteolytic degradation.

For mammalian cell expression, functional reconstitution of bacterial MscL has been demonstrated . This approach is particularly valuable when studying MscL in a eukaryotic membrane environment or for applications involving mammalian cell-based assays. Transient transfection using lipofection or viral delivery systems can achieve adequate expression levels.

If post-translational modifications or specific lipid environments are critical to your research, insect cell expression using baculovirus systems may offer advantages, though with increased complexity and cost.

How can the functionality of recombinant C. curvus MscL be verified after expression?

Verification of functional activity for recombinant C. curvus MscL should employ multiple complementary approaches:

Electrophysiological Characterization:

  • Patch-clamp recording of reconstituted channels in liposomes or planar lipid bilayers

  • Single-channel conductance measurements to confirm pore formation

  • Analysis of tension sensitivity and gating parameters

Fluorescence-Based Assays:

  • Reconstitution in liposomes loaded with fluorescent dyes

  • Monitoring dye release upon channel activation using membrane tension modifiers

  • FRET-based approaches to monitor conformational changes during gating

Cell-Based Functional Verification:

  • Expression in mammalian cells followed by controlled activation

  • Demonstration of uptake of membrane-impermeable fluorescent molecules

  • Assessment of channel gating in response to increased membrane tension

Biochemical Characterization:

  • Circular dichroism spectroscopy to confirm proper secondary structure

  • Size-exclusion chromatography to verify oligomeric state

  • Cross-linking studies to assess channel assembly

A comprehensive verification strategy would combine these approaches to confirm both proper expression and functional activity of the recombinant channel.

What are the critical factors for successful purification of recombinant C. curvus MscL?

Successful purification of recombinant C. curvus MscL requires careful attention to the following factors:

Detergent Selection:
The choice of detergent is critical for maintaining channel stability and function during extraction from membranes. Generally, mild non-ionic detergents like n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are recommended as starting points. A detergent screen is advisable to determine optimal conditions.

Buffer Composition:
Buffers containing 20-50 mM Tris-HCl or HEPES at pH 7.0-8.0 with 100-300 mM NaCl typically provide stability. Addition of glycerol (10-20%) can enhance protein stability during purification.

Affinity Tag Selection:
A polyhistidine tag (His6) at either the N- or C-terminus generally allows efficient purification using immobilized metal affinity chromatography (IMAC). For C. curvus MscL, positioning the tag at a terminus least likely to interfere with channel assembly or function is recommended.

Protease Inhibitors:
Include a complete protease inhibitor cocktail during cell lysis and initial purification steps to prevent degradation.

Temperature Control:
Maintain samples at 4°C throughout purification to minimize protein denaturation.

Reconstitution Considerations:
For functional studies, carefully select lipid composition for reconstitution that mimics bacterial membrane environments. A mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin can approximate bacterial membrane conditions.

What structural features distinguish C. curvus MscL from other bacterial mechanosensitive channels?

While specific structural information about C. curvus MscL is limited, general characteristics can be inferred based on conserved features of bacterial MscL channels:

MscL channels typically form homopentameric structures with each subunit containing two transmembrane domains. The high-resolution structure of M. tuberculosis MscL homologue has served as a model for understanding structural features of MscL channels across bacterial species .

Distinguishing features of C. curvus MscL might include:

  • Sequence variations in the pore-lining regions affecting conductance properties

  • Differences in hydrophobic gating regions impacting tension sensitivity

  • Potential variations in cytoplasmic domains influencing channel regulation

  • Unique residues affecting interaction with the bacterial membrane

A comprehensive sequence alignment analysis with well-characterized MscL proteins from E. coli and M. tuberculosis would highlight potential unique structural elements of C. curvus MscL. These differences could influence channel properties including:

  • Tension sensitivity threshold

  • Channel conductance

  • Ion selectivity

  • Interaction with membrane lipids

  • Subconductance states during gating

What is the optimal experimental setup for studying tension-dependent gating of recombinant C. curvus MscL?

For rigorous investigation of tension-dependent gating of recombinant C. curvus MscL, researchers should consider the following experimental setup:

Patch-Clamp Electrophysiology:

  • Giant spheroplasts or giant unilamellar vesicles (GUVs) containing reconstituted channels

  • Pressure application system capable of precise control and gradual pressure ramps

  • High-resolution recording equipment to capture subconductance states

  • Temperature control system (typically 20-25°C for optimal recording)

Reconstitution Parameters:

  • Defined lipid compositions mimicking bacterial membranes

  • Controlled protein-to-lipid ratios (typically 1:1000 to 1:5000)

  • Vesicle size uniformity verification via dynamic light scattering

Gating Analysis Protocol:

  • Apply negative pressure (suction) in incremental steps (5-10 mmHg)

  • Hold at each pressure for 30-60 seconds to allow equilibration

  • Record single-channel currents at multiple voltages (±40, ±60, ±80 mV)

  • Analyze pressure threshold for initial opening, subconductance states, and full conductance

  • Calculate tension sensitivity using the law of Laplace (T = Pr/2, where P is pressure, r is radius)

When conducting these experiments, it's essential to verify that the functionality of C. curvus MscL in mammalian cell membranes is preserved as has been demonstrated for other bacterial MscL channels .

How can recombinant C. curvus MscL be adapted for controlled molecular delivery applications?

Adapting recombinant C. curvus MscL for controlled molecular delivery applications requires strategic engineering approaches:

Engineering Activation Mechanisms:

  • Introduction of charged residues in the pore region for pH-dependent gating

  • Incorporation of light-sensitive amino acids for optogenetic control

  • Addition of ligand-binding domains for chemical-induced activation

  • Development of charge-induced activation methods similar to established protocols for other MscL channels

Pore Size Optimization:

  • Mutation of pore-lining residues to adjust the effective diameter

  • Characterization using fluorescently labeled cargoes of varying sizes to determine size exclusion limits

  • Analysis of passage rates for molecules of different molecular weights and charges

Delivery Optimization Protocol:

  • Express engineered C. curvus MscL in target cells or reconstitute in liposomes

  • Load delivery vehicles with cargo molecules (fluorescent dyes, peptides, or small proteins)

  • Trigger controlled opening using the engineered activation mechanism

  • Quantify delivery efficiency using confocal microscopy or flow cytometry

  • Optimize activation parameters to balance delivery efficiency and cell viability

Potential Applications:

  • Delivery of membrane-impermeable bioactive peptides like phalloidin

  • Introduction of nucleic acids for transfection

  • Controlled release of therapeutic compounds

  • Cellular extraction of cytoplasmic biomarkers

Successful implementation requires careful characterization of pore size limitations and development of reliable activation methods that preserve cell viability.

What are the molecular mechanisms underlying the adaptation of C. curvus MscL to the specific membrane environment of this pathogen?

The molecular mechanisms of C. curvus MscL adaptation to its native membrane environment likely involve several interrelated factors:

Membrane Composition Interaction:
The lipid environment significantly influences MscL function. C. curvus, as a pathogenic bacterium associated with periodontal disease and gastrointestinal infections , likely possesses membrane adaptations for survival in diverse host environments. These adaptations may include:

  • Hydrophobic matching between the channel's transmembrane domains and the lipid bilayer thickness

  • Specific interactions with unique lipid components in C. curvus membranes

  • Adaptation to membrane properties affecting bilayer stiffness and spontaneous curvature

Sequence Adaptations:
Comparative analysis with other bacterial MscL channels would reveal sequence variations that might contribute to:

  • Altered tension sensitivity thresholds adapted to C. curvus osmotic stress patterns

  • Modified gating kinetics suited to pathogenicity requirements

  • Adjusted conductance properties for specific ion transport needs

Regulatory Mechanisms:
C. curvus MscL may incorporate unique regulatory elements:

  • Cytoplasmic domains with pathogen-specific protein-protein interactions

  • Modified N- or C-terminal regions affecting channel assembly or modulation

  • Adaptation to specific signaling pathways relevant to pathogenic lifestyle

Experimental Approaches for Investigation:

  • Comparative functional studies in native versus synthetic lipid environments

  • Chimeric channel constructs exchanging domains between C. curvus MscL and well-characterized counterparts

  • Site-directed mutagenesis targeting residues at the protein-lipid interface

  • Molecular dynamics simulations to model membrane interactions

Understanding these adaptations could provide insights into both bacterial physiology and pathogenic mechanisms of C. curvus.

What techniques are most effective for studying the structural dynamics of C. curvus MscL during gating?

Multiple complementary techniques provide insights into the structural dynamics of MscL during gating:

Single-Molecule FRET (smFRET):

  • Introduction of fluorescent probes at strategic positions within the channel

  • Real-time monitoring of conformational changes during gating

  • Detection of intermediate states and their lifetimes

  • Advantages: Captures dynamic information in real-time; resolves heterogeneity in molecular behavior

  • Challenges: Requires careful selection of labeling positions; potential interference of labels with function

Cryo-Electron Microscopy (Cryo-EM):

  • Visualization of channels in different conformational states

  • Trapping transitional states using engineered mutants or specific lipid environments

  • Resolution of structural details at near-atomic level

  • Advantages: High-resolution structural information; captures multiple conformational states

  • Challenges: Sample preparation complexity; requirement for protein homogeneity

Molecular Dynamics (MD) Simulations:

  • In silico modeling of channel behavior in defined membrane environments

  • Prediction of conformational changes in response to applied forces

  • Analysis of water and ion permeation during different gating states

  • Advantages: Provides atomistic details of dynamics; can test hypotheses before experimental validation

  • Challenges: Computational intensity; validation of simulation parameters

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Mapping solvent accessibility changes during gating

  • Identification of dynamic regions and stable structural elements

  • Comparative analysis between resting and activated states

  • Advantages: Does not require protein crystallization; provides regional dynamics information

  • Challenges: Limited spatial resolution; requires careful interpretation

Site-Directed Spin Labeling (SDSL) with EPR Spectroscopy:

  • Introduction of spin labels at specific residues

  • Measurement of distances between labeled sites during channel operation

  • Monitoring of environmental changes surrounding the labels

  • Advantages: High sensitivity to conformational changes; works in native-like membranes

  • Challenges: Potential functional interference; requires strategic label placement

How might C. curvus MscL function contribute to the pathogenicity of this organism in human infections?

The potential role of MscL in C. curvus pathogenicity represents an intriguing research question with several hypothetical mechanisms:

Osmotic Stress Adaptation:
C. curvus causes infections in diverse anatomical sites, including periodontal tissues, gastrointestinal tract, and intra-abdominal collections . These environments present varying osmotic challenges. MscL likely plays a critical role in:

  • Adaptation to osmotic shifts during tissue invasion

  • Survival during inflammatory responses where osmolarity fluctuates

  • Protection against osmotic lysis in different host microenvironments

Virulence Factor Secretion:
Given the large pore diameter of MscL (>25 Å) , it might potentially function in:

  • Release of small virulence factors during specific infection stages

  • Response to host-induced membrane stress during infection

  • Contribution to membrane permeability changes affecting antibiotic sensitivity

Host Immune Response Interaction:
MscL function may influence:

  • Bacterial response to antimicrobial peptides that disrupt membrane integrity

  • Adaptation to phagosomal environments during interactions with immune cells

  • Survival during exposure to bile acids in gastrointestinal infections

Clinical Correlation:
C. curvus has been isolated from diverse infection sites including:

  • Bloody gastroenteritis cases

  • Brainerd's diarrhea outbreaks

  • Intra-abdominal collections

The variable presentation of C. curvus infections suggests complex adaptability to different host environments, where MscL may play a significant role in bacterial survival and virulence.

Research Implications:
Investigations into C. curvus MscL's contribution to pathogenicity would be valuable for:

  • Identifying potential therapeutic targets

  • Understanding bacterial adaptation to host environments

  • Elucidating mechanisms of persistent infection

What isolation and identification methods are most effective for obtaining C. curvus samples for MscL research?

Effective isolation and identification of C. curvus requires specialized techniques:

Optimal Isolation Protocol:

  • Collection of appropriate clinical specimens (oral samples for periodontal disease, stool for gastrointestinal infections, or aspirates from collections)

  • Filtration through 0.45-μm-pore-size filters onto blood agar plates (BAP)

  • Incubation under microaerophilic conditions (5% O2, 10% CO2, 85% N2)

  • Extended incubation period (>3 days) which is critical for recovery

  • Selection of suspect colonies for further identification

Identification Methodologies:
The following techniques have proven effective for C. curvus identification:

MethodAdvantagesLimitationsReference
MALDI-TOF MSRapid identification with high probability scores (>2.0)Requires up-to-date database
16S rRNA Gene SequencingGold standard for definitive identificationTime-consuming, technically demanding
Whole-Genome SequencingComprehensive genetic information, confirms speciationExpensive, requires bioinformatics expertise
Biochemical TestingAccessible in many laboratoriesLess specific for C. curvus, variable results

Key Distinguishing Features:

  • C. curvus is catalase variable (50% positive) and indoxyl acetate variable (15% positive)

  • H2S production on TSI is variable (40% positive), but all strains are positive by lead acetate paper method

  • CFA analysis shows straight-chained saturated and monounsaturated fatty acids without branched-chain fatty acids

Challenges and Solutions:

  • Low prevalence in clinical samples: Use specific isolation methods and prolonged incubation

  • Intervening sequences in 16S rRNA genes: Use alternative gene targets or whole-genome approaches

  • Phenotypic variability: Rely on molecular methods for definitive identification

These specialized techniques are essential for obtaining authentic C. curvus isolates for subsequent MscL research.

What are the recommended approaches for comparative analysis of C. curvus MscL with other bacterial mechanosensitive channels?

Comprehensive comparative analysis of C. curvus MscL with other bacterial mechanosensitive channels should incorporate:

Sequence-Based Comparisons:

  • Multiple sequence alignment of C. curvus MscL with well-characterized homologues (E. coli, M. tuberculosis)

  • Phylogenetic analysis to establish evolutionary relationships

  • Identification of conserved domains and variable regions

  • Prediction of critical functional residues based on conservation patterns

Structural Comparison:

  • Homology modeling based on crystal structures of related MscL channels

  • Superimposition of structural models to identify conformational differences

  • Analysis of pore-lining residues affecting conductance and selectivity

  • Comparison of transmembrane domains and their membrane interaction surfaces

Functional Characterization:

  • Patch-clamp analysis of channel conductance under standardized conditions

  • Measurement of gating tension thresholds in defined lipid environments

  • Comparative analysis of subconductance states during channel opening

  • Assessment of ion selectivity and voltage dependence

Standardized Experimental Design:

ParameterStandardization ApproachRelevance
Expression SystemIdentical vectors and host cellsEliminates expression-related variability
ReconstitutionDefined synthetic lipid compositionsControls for membrane environment effects
ElectrophysiologyConsistent recording conditionsAllows direct comparison of functional parameters
Activation MethodsStandardized pressure protocolsEnables quantitative comparison of gating properties

Cross-Species Chimeric Analysis:

  • Generation of chimeric constructs exchanging domains between C. curvus MscL and other bacterial MscLs

  • Functional characterization to map domain-specific contributions to gating properties

  • Identification of regions conferring species-specific characteristics

This multifaceted approach provides insights into conserved mechanisms of mechanosensation while highlighting adaptations specific to C. curvus.

What techniques enable visualization of C. curvus MscL gating in real-time?

Real-time visualization of MscL gating dynamics requires specialized techniques that balance temporal resolution with structural detail:

Advanced Fluorescence Imaging Approaches:

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET)

    • Strategic labeling of channel subunits with donor-acceptor fluorophore pairs

    • Detection of distance changes during gating using total internal reflection fluorescence (TIRF) microscopy

    • Real-time tracking of conformational changes with millisecond resolution

    • Analysis of conformational heterogeneity and intermediate states

  • Fluorescence Quenching Assays

    • Reconstitution of channels in liposomes containing self-quenching dyes

    • Monitoring dye release upon channel activation

    • Quantification of open probability under varying tension conditions

    • High-throughput screening of gating modulators

  • Voltage-Sensitive Dye Imaging

    • Incorporation of voltage-sensitive fluorophores into channel-containing membranes

    • Detection of local electric field changes during ion permeation

    • Correlation of fluorescence intensity with channel activity

Live Cell Imaging Techniques:

  • Cargo Molecule Influx Visualization

    • Expression of C. curvus MscL in mammalian cells

    • Application of membrane tension or engineered activation methods

    • Real-time imaging of fluorescent cargo molecule entry through activated channels

    • Quantification of channel activity through fluorescence intensity measurements

  • Calcium Imaging

    • Co-expression of calcium indicators with MscL channels

    • Detection of calcium influx as a proxy for channel activation

    • High spatial and temporal resolution of channel activity in cellular contexts

Correlative Microscopy Approaches:

  • Combined Patch-Clamp and Fluorescence Imaging

    • Simultaneous electrophysiological recording and fluorescence visualization

    • Direct correlation between current measurements and structural changes

    • Integration of functional and structural data from the same channels

  • High-Speed Atomic Force Microscopy (HS-AFM)

    • Topographical imaging of channel conformational changes in membrane environments

    • Sub-second temporal resolution of structural dynamics

    • Visualization of channel assembly and subunit interactions

These visualization techniques provide complementary information about channel dynamics, from global conformational changes to functional consequences of gating.

How can researchers engineer C. curvus MscL for controlled activation in experimental systems?

Engineering C. curvus MscL for controlled activation requires strategic modifications that preserve channel structure while enabling selective gating:

Site-Directed Mutagenesis Approaches:

  • Charge-Induced Activation

    • Introduction of cysteine residues at strategic positions in the pore region

    • Conjugation with charged methanethiosulfonate (MTS) reagents

    • Creation of electrostatic repulsion triggering channel opening

    • Advantage: Established method with proven effectiveness in other MscL channels

  • pH-Sensitive Gating

    • Substitution of key residues with histidines (pKa ~6.0)

    • Channel activation upon pH changes through protonation/deprotonation

    • Titration of activation threshold by adjusting histidine positions

    • Advantage: Reversible activation using physiologically relevant pH ranges

  • Redox-Controlled Gating

    • Introduction of cysteine pairs forming disulfide bridges

    • Channel modulation through oxidizing/reducing conditions

    • Tunable activation based on redox potential

    • Advantage: Physiologically relevant trigger mechanism

Advanced Engineering Approaches:

  • Optogenetic Control

    • Fusion with light-sensitive domains (e.g., LOV domain, cryptochrome)

    • Light-induced conformational changes triggering channel opening

    • Spatiotemporal control with appropriate wavelength illumination

    • Advantage: High spatial and temporal precision

  • Ligand-Gated Systems

    • Incorporation of ligand-binding domains from other proteins

    • Channel activation upon specific ligand binding

    • Tunable sensitivity through binding domain modifications

    • Advantage: Chemical specificity and dose-dependent control

Implementation Protocol:

  • In silico modeling to identify optimal modification sites

  • Generation of mutant constructs using standard molecular biology techniques

  • Expression and purification of engineered channels

  • Functional verification using electrophysiology and fluorescence-based assays

  • Optimization of activation parameters (concentration, light intensity, pH range)

Validation Methods:

Engineering ApproachPrimary ValidationSecondary Validation
Charge-InducedPatch-clamp electrophysiologyFluorescent dye release
pH-SensitivepH titration curvesCell swelling assays
Redox-ControlledWestern blot for disulfide formationSingle channel recordings
OptogeneticLight-dependent current measurementsCellular cargo uptake
Ligand-GatedDose-response relationshipsFRET-based conformational analysis

These engineering strategies enable precise control over C. curvus MscL activation, facilitating research applications including controlled molecular delivery into cells .

What are the considerations for optimizing lipid environment for recombinant C. curvus MscL functional studies?

The lipid environment critically influences MscL function, making careful optimization essential for recombinant C. curvus MscL studies:

Key Lipid Parameters Affecting MscL Function:

  • Bilayer Thickness:

    • Hydrophobic mismatch between transmembrane domains and bilayer affects tension sensitivity

    • Thinner bilayers typically lower activation threshold while thicker bilayers increase it

    • Optimization through systematic testing of lipids with different acyl chain lengths

  • Membrane Stiffness:

    • Affects energy required for channel opening

    • Modulated by cholesterol content, unsaturation level of fatty acids, and temperature

    • Critical parameter for standardization across comparative studies

  • Spontaneous Curvature:

    • Influences local deformation energy during channel gating

    • Modified by incorporating lipids with different head group sizes or conical shapes

    • Can be used to tune channel sensitivity

Lipid Composition Optimization Strategy:

Lipid TypeFunctionStarting PercentageOptimization Range
POPCBasic matrix lipid50-70%40-80%
POPENegative curvature15-25%10-40%
POPGNegative charge10-20%5-30%
CardiolipinBacterial membrane mimetic5-10%0-15%
CholesterolModulates fluidity0-5%0-20%

Systematic Optimization Protocol:

  • Begin with a basic reconstitution system mimicking bacterial membranes (POPE/POPG mixture)

  • Systematically vary single lipid components while monitoring channel function

  • Measure tension sensitivity, conductance, and kinetic parameters for each composition

  • Create empirical models relating lipid parameters to channel function

  • Select optimal compositions for specific experimental objectives

Native-Like Environment Considerations:

For C. curvus, which has been isolated from diverse infection sites including periodontal tissues and intra-abdominal collections , consider:

  • pH stability of reconstituted systems (pH 5.5-8.0 range to mimic different infection sites)

  • Ionic strength variations reflecting different host environments

  • Presence of host-derived lipids or membrane-active compounds

Verification Methods:

  • Differential scanning calorimetry to verify lipid phase behavior

  • Dynamic light scattering to confirm vesicle size distribution

  • Fluorescence anisotropy measurements to assess membrane fluidity

  • Electron microscopy to verify membrane morphology

Optimizing lipid environments for C. curvus MscL studies requires systematic investigation of these parameters to establish conditions that enable reproducible functional assessments while potentially revealing environment-specific adaptations of this bacterial channel.

How might C. curvus MscL research contribute to understanding bacterial adaptation to host environments?

Research on C. curvus MscL offers unique insights into bacterial adaptation to diverse host environments:

Osmotic Adaptation Mechanisms:
C. curvus has been isolated from various human infection sites including periodontal tissues, gastrointestinal tract, and intra-abdominal collections . These environments present distinct osmotic challenges. MscL research can reveal:

  • Specialized tension sensitivity adaptations for survival in different host microenvironments

  • Unique gating properties reflecting niche-specific evolutionary pressures

  • Comparative analysis with free-living bacteria to identify pathogen-specific adaptations

Host-Pathogen Interface:
MscL function may represent a critical adaptation at the host-pathogen interface:

  • Protection against antimicrobial peptides that perturb membrane integrity

  • Survival during phagocytosis and exposure to intracellular osmotic fluctuations

  • Adaptation to inflammatory environments where osmolarity changes rapidly

Comparative Genomic Insights:
Investigation of C. curvus MscL in the context of its genome can reveal:

  • Conservation and divergence patterns compared to non-pathogenic bacteria

  • Co-evolution with other membrane proteins involved in stress response

  • Genetic regulation mechanisms responding to host-associated signals

Translational Research Applications:

Research DirectionPotential OutcomeClinical Relevance
Tension sensitivity comparisonIdentification of pathogen-specific adaptationsNovel antimicrobial targets
MscL inhibitor developmentCompounds affecting osmotic regulationAdjunctive therapy for infections
Expression regulation studiesUnderstanding of environmental responsive elementsInsights into persistence mechanisms
Structure-function analysisIdentification of unique functional domainsSpecificity determinants for drug design

Methodological Approaches:

  • In vitro infection models examining MscL expression and function during host cell interaction

  • Animal models of C. curvus infection assessing the role of MscL in colonization and virulence

  • Comparative analysis of clinical isolates from different anatomical sites

  • Heterologous expression studies comparing function in different membrane environments

This research would contribute significantly to understanding how bacterial mechanosensitive channels adapt to the host environment, potentially revealing new therapeutic targets for C. curvus infections.

What are the potential applications of recombinant C. curvus MscL in drug delivery research?

Recombinant C. curvus MscL offers numerous promising applications in drug delivery research:

Advantages of MscL-Based Delivery Systems:

  • Large Pore Diameter:
    The >25 Å pore diameter of MscL permits passage of a wide range of molecules including:

    • Small proteins and peptides

    • Nucleic acids (siRNA, miRNA)

    • Imaging agents and contrast media

    • Small molecule therapeutics

  • Controllable Activation:
    Engineered activation mechanisms allow precise control over:

    • Timing of cargo release

    • Duration of pore opening

    • Reversibility of the delivery system

    • Spatial targeting through localized triggers

  • Versatile Delivery Platforms:
    MscL can be incorporated into various delivery systems:

    • Liposomal formulations for systemic delivery

    • Cell-based delivery vehicles

    • Implantable controlled release devices

    • Transdermal delivery systems

Specific Research Applications:

  • Intracellular Delivery of Membrane-Impermeable Compounds:

    • Introduction of phalloidin and other cytoskeleton-binding molecules

    • Delivery of CRISPR-Cas components for gene editing

    • Transport of signaling pathway modulators

    • Introduction of intracellular diagnostic probes

  • Triggered Release Systems:

    • pH-responsive delivery to specific anatomical sites

    • Redox-triggered release in specific cellular compartments

    • Light-activated delivery for spatiotemporal precision

    • Mechanically triggered release at target tissues

  • Cell-Specific Targeting:

    • Conjugation with targeting ligands for cell-specific binding

    • Integration into cell-specific extracellular vesicles

    • Combination with cell-penetrating peptides

    • Incorporation into targeted nanoparticle systems

Development Pathway and Challenges:

Development StageKey ConsiderationsTechnical Approaches
Initial DesignCargo compatibility with pore dimensionsSize exclusion analysis with model compounds
Engineering OptimizationReliable activation mechanismsSite-directed mutagenesis and functional screening
Delivery Vehicle IntegrationMaintaining channel orientation and functionControlled reconstitution techniques
Cargo LoadingEfficient encapsulation methodsGradient-driven loading or co-reconstitution
In Vitro ValidationQuantification of delivery efficiencyFluorescence-based assays and microscopy
In Vivo TestingBiodistribution and pharmacokineticsImaging-based tracking and functional readouts

Future Research Directions:

  • Development of C. curvus MscL variants with tailored pore sizes for specific cargo molecules

  • Creation of dual-responsive systems combining multiple activation triggers

  • Investigation of channel modifications enhancing stability in delivery formulations

  • Integration with existing drug delivery technologies for enhanced functionality

The unique properties of bacterial MscL channels, demonstrated in controlled delivery of bioactive molecules into live cells , position C. curvus MscL as a promising component for next-generation drug delivery systems.

How does studying C. curvus MscL contribute to our understanding of bacterial mechanosensation diversity?

Investigating C. curvus MscL provides valuable insights into the diversity of bacterial mechanosensation strategies:

Evolutionary Perspectives:
C. curvus occupies a distinct ecological niche as a human pathogen associated with periodontal disease and gastrointestinal infections . Studying its MscL channel reveals:

  • Evolutionary adaptations specific to host-associated bacteria

  • Selective pressures shaping mechanosensation in pathogens versus environmental bacteria

  • Conservation patterns indicating core functional requirements versus niche-specific adaptations

Structural and Functional Diversity:
Comparative analysis of C. curvus MscL with well-characterized channels from E. coli and M. tuberculosis illuminates:

  • Variation in channel architecture influencing gating mechanics

  • Differences in tension sensitivity thresholds reflecting habitat-specific requirements

  • Diversity in regulatory mechanisms controlling channel activation

  • Variations in ion conductance and selectivity properties

Physiological Role Diversity:
The functional significance of MscL may vary across bacterial species:

  • In free-living bacteria: primarily osmotic safety valve

  • In host-associated bacteria like C. curvus: potential roles in:

    • Adaptation to host defense mechanisms

    • Survival during inflammatory responses

    • Persistence during antibiotic treatment

    • Virulence factor release

Methodological Contributions:
Developing techniques for C. curvus MscL characterization advances broader mechanosensation research through:

  • Optimization of isolation and purification protocols for challenging bacterial proteins

  • Refinement of functional assays for tension-sensitive channels

  • Development of comparative frameworks for analyzing mechanosensitive channel diversity

  • Creation of standardized approaches for heterologous expression and characterization

Comprehensive Diversity Analysis:

Diversity AspectResearch ApproachExpected Insights
Sequence DiversityComparative genomics across Campylobacter speciesIdentification of conserved domains and variable regions
Structural VariabilityHomology modeling and structural analysisSpecies-specific architectural adaptations
Functional DiversityStandardized electrophysiological characterizationQuantitative differences in gating properties
Regulatory VariationExpression analysis under different conditionsSpecies-specific control mechanisms
Ecological CorrelationHabitat analysis linked to channel propertiesEnvironment-function relationships

This research contributes to a comprehensive understanding of how mechanosensitive channels have evolved to meet the specific needs of diverse bacterial species across different ecological niches, including host-associated environments.

What challenges remain in structural determination of C. curvus MscL and how might they be addressed?

Structural determination of C. curvus MscL presents several significant challenges requiring innovative approaches:

Key Challenges and Strategic Solutions:

  • Protein Expression and Purification:

    • Challenge: Membrane proteins like MscL typically express at low levels and present difficulties in solubilization and purification.

    • Solutions:

      • Optimization of expression using specialized vectors with strong, inducible promoters

      • Screening multiple host systems (E. coli, yeast, insect cells)

      • Testing fusion partners (SUMO, MBP) to enhance solubility and expression

      • Systematic detergent screening for optimal extraction and stability

  • Conformational Heterogeneity:

    • Challenge: MscL exists in multiple conformational states, creating heterogeneity that complicates structural studies.

    • Solutions:

      • Engineering conformationally restricted mutants that favor specific states

      • Use of nanobodies or fragment antibodies to stabilize particular conformations

      • Application of chemical cross-linking to capture specific states

      • Single-particle classification approaches in cryo-EM analysis

  • Crystallization Difficulties:

    • Challenge: Membrane proteins are notoriously difficult to crystallize due to limited polar surface area.

    • Solutions:

      • Lipidic cubic phase (LCP) crystallization methods

      • Systematic screening of detergent/lipid mixtures

      • Introduction of crystallization chaperones or fusion partners

      • Antibody fragment co-crystallization to increase polar surface area

  • Protein Stability:

    • Challenge: Maintaining stability of C. curvus MscL during purification and structural studies.

    • Solutions:

      • Thermal stability assays to identify optimal buffer conditions

      • Addition of specific lipids known to enhance stability

      • Use of stabilizing ligands or amphipols

      • Mutagenesis to enhance thermostability without affecting function

Comparative Methodology Assessment:

MethodAdvantages for MscL StructureLimitationsStrategic Adaptations
X-ray CrystallographyAtomic resolutionCrystallization challengesLCP techniques, fusion partners
Cryo-EMNo crystallization needed; captures multiple statesResolution limitations for smaller proteinsAntibody complexes to increase size; focused refinement
NMR SpectroscopyDynamic information; solution stateSize limitationsSelective labeling; divide-and-conquer approach
AFMMembrane environment; conformational dynamicsLimited resolutionHigh-speed AFM; correlation with other methods
Integrative ModelingCombines multiple data sourcesRequires experimental validationHybrid approaches with cross-linking and mass spectrometry

Implementation Roadmap:

  • Short-term approach: Homology modeling based on M. tuberculosis MscL structure combined with molecular dynamics simulations to predict C. curvus-specific features.

  • Medium-term strategy: Cryo-EM studies of recombinant C. curvus MscL reconstituted in nanodiscs or amphipols, focusing on multiple conformational states.

  • Long-term goal: High-resolution crystal structure of C. curvus MscL in multiple conformational states using optimized constructs and crystallization conditions.

Addressing these challenges will not only advance understanding of C. curvus MscL but also contribute to broader methodological developments for structural biology of challenging membrane proteins.

How might genomic and proteomic approaches enhance our understanding of C. curvus MscL regulation and expression?

Genomic and proteomic approaches offer powerful strategies for comprehensively understanding C. curvus MscL regulation and expression:

Genomic Approaches:

  • Comparative Genomics:

    • Analysis of MscL gene conservation across C. curvus strains from different clinical sources

    • Identification of strain-specific variations that might influence channel function

    • Examination of genome organization surrounding the MscL gene to identify potential co-regulated genes

  • Transcriptomic Analysis:

    • RNA-Seq to profile MscL expression under various environmental conditions:

      • Osmotic stress conditions

      • Different pH environments mimicking host niches

      • Biofilm versus planktonic growth

      • Exposure to host factors

    • Identification of transcriptional start sites and regulatory elements using 5'-RACE

    • Detection of small RNAs potentially involved in post-transcriptional regulation

  • Epigenomic Analysis:

    • Investigation of DNA methylation patterns affecting MscL expression

    • Chromatin immunoprecipitation (ChIP-Seq) to identify transcription factors binding to the MscL promoter

    • Analysis of DNA supercoiling effects on MscL expression

Proteomic Approaches:

  • Global Proteome Analysis:

    • Quantitative proteomics to measure MscL abundance across growth conditions

    • Correlation of MscL expression with other membrane proteins

    • Identification of proteins co-regulated with MscL

  • Post-Translational Modifications:

    • Mass spectrometry-based identification of PTMs on MscL protein

    • Investigation of potential phosphorylation, glycosylation, or lipid modifications

    • Analysis of how PTMs affect channel function and membrane localization

  • Protein-Protein Interactions:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

    • Two-hybrid or split-protein complementation assays for interaction partners

Integrated Multi-Omics Strategies:

ApproachTechniquesExpected Insights
Regulon AnalysisChIP-Seq + RNA-SeqIdentification of co-regulated genes and regulatory networks
Stress Response ProfilingProteomics + TranscriptomicsCorrelation between transcript and protein levels during stress
Evolution of RegulationComparative Genomics + ProteomicsSpecies-specific adaptations in regulation mechanisms
Host Interaction EffectsRNA-Seq during infection modelsExpression changes in response to host environments

Translation to Functional Insights:

  • Structure-Function Correlation:

    • Linking genetic variations to functional differences through electrophysiological characterization

    • Correlation of PTMs with altered channel properties

    • Assessment of how interaction partners modulate channel activity

  • Regulatory Network Mapping:

    • Construction of gene regulatory networks controlling MscL expression

    • Identification of master regulators responding to environmental cues

    • Elucidation of feedback mechanisms controlling channel abundance

  • Pathogenicity Connections:

    • Correlation of MscL expression patterns with virulence traits

    • Investigation of MscL expression during various stages of infection

    • Analysis of channel regulation in antibiotic-resistant versus susceptible strains

These comprehensive approaches would provide unprecedented insights into how C. curvus regulates MscL expression and function across different environmental conditions, particularly those encountered during human infection .

What are the most promising future directions for C. curvus MscL research?

The study of recombinant Campylobacter curvus large-conductance mechanosensitive channel (MscL) presents several promising research trajectories that could significantly advance both fundamental science and applied biotechnology:

Fundamental Science Directions:

  • Structural Biology Advancements

    • High-resolution structural determination in multiple conformational states

    • Elucidation of C. curvus-specific structural adaptations

    • Comparative structural analysis across the Campylobacter genus

  • Mechanosensation Diversity

    • Comprehensive functional characterization of tension sensitivity parameters

    • Identification of species-specific adaptations in gating mechanisms

    • Investigation of evolutionary pressures shaping mechanosensitive channels in pathogens

  • Pathogenicity Connections

    • Elucidation of MscL's role in C. curvus survival during infection

    • Investigation of connections between mechanosensation and virulence

    • Understanding osmotic adaptation in various host environments

Translational Research Opportunities:

  • Drug Delivery Applications

    • Optimization of controlled molecular delivery systems using C. curvus MscL

    • Development of stimuli-responsive release mechanisms

    • Creation of cell-specific targeting strategies

  • Antimicrobial Development

    • Identification of MscL as a potential novel drug target

    • Development of channel-specific inhibitors

    • Exploration of synergistic effects with existing antibiotics

  • Diagnostic Applications

    • Development of MscL-based biosensors for tension or other physiological parameters

    • Creation of detection systems for specific bioactive molecules

    • Application in high-throughput screening platforms

Technological Innovation Areas:

  • Advanced Protein Engineering

    • Creation of chimeric channels with novel properties

    • Development of sensors based on conformational changes

    • Engineering of channels with tailored conductance and selectivity properties

  • Improved Isolation and Characterization Methods

    • Refinement of techniques for isolation of challenging Campylobacter species

    • Development of standardized functional characterization protocols

    • Creation of high-throughput screening methods for channel modulators

The intersection of these research directions, particularly the combination of structural insights with functional characterization and application development, represents the most promising path forward for C. curvus MscL research, with potential impacts spanning from basic bacterial physiology to innovative biotechnological applications.

How might research on C. curvus MscL benefit broader fields beyond bacteriology?

Research on C. curvus MscL has far-reaching implications that extend beyond bacteriology into diverse scientific and medical fields:

Biophysics and Membrane Dynamics:
The study of MscL provides fundamental insights into how proteins sense and respond to mechanical forces in lipid bilayers. C. curvus MscL research contributes to understanding:

  • General principles of mechanotransduction across biological systems

  • Lipid-protein interactions governing membrane protein function

  • Energetics of conformational changes in membrane proteins

  • Physical principles of tension sensing in biological membranes

Synthetic Biology and Bioengineering:
MscL channels represent valuable building blocks for synthetic biological systems:

  • Development of tension-responsive genetic circuits

  • Creation of cellular osmoregulatory modules

  • Engineering of controlled molecular release systems

  • Design of biosensors for mechanical and chemical stimuli

Drug Delivery and Nanomedicine:
The large pore size and controllable gating make MscL an attractive component for advanced drug delivery:

  • Controlled release of therapeutic molecules

  • Overcoming cellular barriers to drug delivery

  • Development of stimuli-responsive nanomedicines

  • Creation of cell-specific delivery strategies

Evolutionary Biology:
Comparative analysis of C. curvus MscL with homologs from other organisms provides:

  • Insights into protein evolution under different selective pressures

  • Understanding of adaptation mechanisms in host-associated bacteria

  • Models for studying structure-function relationships in evolved proteins

  • Perspectives on convergent evolution of mechanosensitive systems

Medical and Pharmaceutical Applications:

FieldPotential ApplicationsSocietal Impact
Infectious DiseaseNovel antibacterial targets; virulence inhibitorsAddressing antibiotic resistance challenges
Cancer TherapyControlled delivery of cytotoxic agents; triggered release systemsEnhanced specificity of therapeutic delivery
DiagnosticsBiosensors for disease biomarkers; molecular detection platformsEarlier and more accurate disease detection
Tissue EngineeringMechanoresponsive materials; biomimetic interfacesAdvanced regenerative medicine approaches

Interdisciplinary Scientific Advancement:
The methodologies developed for C. curvus MscL research contribute to:

  • Advanced membrane protein structural biology techniques

  • Refined approaches for heterologous expression of challenging proteins

  • Innovative functional characterization methods for ion channels

  • Integrative computational models of protein dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.