Recombinant Campylobacter curvus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant nuoK is typically expressed in E. coli systems with an N-terminal His-tag for purification. Specifications from commercial vendors include:

ParameterCreative Biomart Creative Biolabs
Expression SystemE. coliE. coli/Yeast/Baculovirus
Purity>90% (SDS-PAGE)Not explicitly stated
StorageLyophilized, -20°C/-80°CTris/PBS buffer, -20°C/-80°C
ApplicationsStructural studies, ETC researchVaccine development, research

Functional Role in Bacterial Respiration

  • Electron Transport: In Campylobacter species, nuoK contributes to the membrane-bound module of complex I, facilitating quinone reduction and proton translocation .

  • Essentiality: Mutagenesis studies in C. jejuni (a close relative) show that disruptions in nuo genes impair growth in amino acid-based media unless supplemented with alternative electron donors like formate . This suggests nuoK’s role is non-redundant in ETC flexibility.

Research Applications

  • Antimicrobial Target Exploration: As a component of a critical respiratory enzyme, nuoK is a potential target for inhibiting Campylobacter growth .

  • Vaccine Development: Recombinant nuoK is listed as a candidate antigen for Campylobacter vaccine research, though no clinical trials are reported .

  • Structural Biology: Used in crystallography and mutagenesis to map complex I’s architecture and mechanism .

Limitations and Future Directions

Current data gaps include:

  • Direct functional assays of C. curvus nuoK in vivo.

  • Structural comparisons with nuoK homologs in pathogenic Campylobacter species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please specify it during order placement. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery information, kindly contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Ccur92_01480; CCV52592_1519; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Campylobacter curvus (strain 525.92)
Target Names
nuoK
Target Protein Sequence
MITLSHYLVVAALMFVLGLIGIMKRNNLIMLFFSSEILLNAANVALAAISKFYNDITGQI FALFIVAVAASEVAVGLGLLILWYKKTGSIELSSMNNMRD
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what role does it play in Campylobacter curvus metabolism?

NADH-quinone oxidoreductase (Complex I) is a key enzyme in bacterial electron transport chains that couples the oxidation of NADH to NAD+ with the reduction of quinones, ultimately contributing to energy conservation through proton translocation. The nuoK subunit is one of the membrane-embedded components of this complex that participates in the proton-pumping machinery. In Campylobacter species, this enzyme is particularly important for energy metabolism under varying oxygen conditions, which is crucial as these organisms typically inhabit microaerobic environments .

In C. curvus specifically, nuoK likely plays a critical role in energy conversion during growth in the human gastrointestinal tract, where oxygen gradients require metabolic flexibility. This is supported by studies in related species showing that Campylobacter adapts its respiration pathways to changing oxygen concentrations in colonization sites . The ability to modulate energy production systems in response to environmental cues appears to be essential for C. curvus survival in its ecological niches.

How does Campylobacter curvus adapt its metabolism to different oxygen conditions?

Campylobacter curvus, like other members of the Campylobacteria class, must adjust its metabolism and respiration to changing oxygen concentrations. The adaptation mechanisms include:

  • Alternative terminal electron acceptors: Under oxygen-limited conditions, C. curvus may utilize alternative terminal electron acceptors. Research on related Campylobacter species has shown that they can use fumarate as a terminal electron acceptor when oxygen is limited .

  • Cytochrome systems: C. curvus likely possesses high-affinity respiratory systems similar to those in C. jejuni, which include the cbb3-type cytochrome c oxidase that can function at extremely low oxygen concentrations (in the nM range) .

  • Regulatory controls: The CemR regulatory protein, identified in C. jejuni and likely present in C. curvus, controls the transcription of genes involved in the tricarboxylic acid cycle and respiration pathways in response to changing oxygen availability . This regulator is essential for these bacteria to reprogram their metabolism efficiently and produce sufficient ATP under varying conditions.

  • C4-dicarboxylate transport and utilization: Under low oxygen conditions, Campylobacter species upregulate genes related to C4-dicarboxylate transport and utilization, including succinate dehydrogenase and fumarate reductase, which allows for metabolic flexibility .

What is known about the rHURM pathway in Campylobacter curvus and how might it interact with energy metabolism?

The reverse Hydroxylamine Ubiquinone Redox Module (rHURM) represents a potentially novel mechanism for chemotrophic respiration in Campylobacter curvus. This dissimilatory nitrate reduction pathway utilizes a hydroxylamine intermediate and was originally discovered in the chemoautolithotroph Nautilia profundicola .

Key components of the rHURM pathway in C. curvus include:

  • Periplasmic nitrate reductase (NapA): Reduces nitrate to nitrite in the periplasm.

  • Hydroxylamine oxidoreductase (hao) homolog: An octoheme potentially capable of reducing nitrite to hydroxylamine in the absence of classic nitrite reductase genes.

  • Hydroxylamine reductase hybrid cluster protein (Hcp): Converts hydroxylamine to ammonium.

This pathway may interact with energy metabolism by providing alternative electron flow pathways under oxygen-limited conditions, potentially linking to the electron transport chain in which nuoK participates. The interaction between the rHURM pathway and Complex I (including nuoK) would represent an important adaptation mechanism for C. curvus in microaerobic or anaerobic environments.

What are the key phenotypic and biochemical characteristics of Campylobacter curvus relevant to energy metabolism studies?

Campylobacter curvus displays several key characteristics that are relevant to energy metabolism studies:

CharacteristicC. curvus phenotypeRelevance to metabolism studies
OxidasePositive (100%)Indicates terminal oxidase activity for oxygen respiration
CatalaseVariable (50% positive)Affects response to oxidative stress and oxygen handling
Growth at 35°CPositive (100%)Standard temperature for metabolic studies
Growth at 42°CPositive (100%)Alternative temperature for metabolic regulation studies
Growth in 1% GlycinePositive (100%)Tolerance to amino acid that may affect membrane integrity
H₂S production (lead acetate)Positive (100%)Indicates sulfur metabolism capabilities
Microaerophilic growthRequiredCentral to understanding respiratory adaptations

These characteristics, derived from studies of clinical isolates , provide a foundation for understanding the metabolic capabilities of C. curvus and designing appropriate conditions for nuoK functional studies.

How might oxygen limitation affect nuoK expression and function in Campylobacter curvus?

Based on studies of related Campylobacteria, oxygen limitation likely has significant effects on nuoK expression and function in C. curvus:

  • Transcriptional regulation: In C. jejuni, genes encoding components of the electron transport chain show differential expression under varying oxygen conditions. CemR, a regulatory protein, has been identified as controlling the metabolic shift related to oxygen availability . It's likely that nuoK expression in C. curvus is similarly regulated in response to oxygen levels.

  • Functional adaptation: Under low oxygen conditions, the NADH-quinone oxidoreductase complex may undergo functional adaptations to optimize electron flow. This could involve altered interactions between the nuoK subunit and other components of the respiratory chain to maintain energy production despite limited terminal electron acceptor availability.

  • Integration with alternative pathways: Oxygen limitation may trigger integration of Complex I activity with alternative respiratory pathways, such as the rHURM pathway . This integration would require coordinated regulation of nuoK and genes involved in alternative electron transport chains.

  • Energy efficiency adjustments: The stoichiometry of proton pumping by Complex I might be modulated under oxygen limitation to maintain membrane potential despite reduced electron flux, potentially affecting the conformational dynamics of membrane subunits like nuoK.

What is the relationship between the tricarboxylic acid (TCA) cycle and NADH-quinone oxidoreductase in C. curvus under varying oxygen conditions?

The relationship between the TCA cycle and NADH-quinone oxidoreductase in C. curvus likely follows similar patterns to those observed in related Campylobacter species, with important adaptations to oxygen availability:

  • Metabolic flux coordination: Under oxygen-rich conditions, the TCA cycle operates primarily in the oxidative direction, generating NADH that is then oxidized by the NADH-quinone oxidoreductase complex. Studies in C. jejuni show that succinate dehydrogenase (sdhA), a key TCA cycle enzyme, is upregulated 32.11-fold during colonization of chick ceca, suggesting an important role even under lower oxygen conditions .

  • Bidirectional enzyme function: Both succinate dehydrogenase and fumarate reductase are upregulated in C. jejuni under low oxygen conditions in vivo . This suggests that C. curvus might similarly utilize these enzymes bidirectionally, allowing the TCA cycle to function in both oxidative and reductive modes depending on oxygen availability. This flexibility would affect the NADH/NAD+ ratio and consequently Complex I activity.

  • Regulatory coordination: The CemR regulator identified in Campylobacteria has been shown to control the transcription of genes involved in the TCA cycle and respiration pathways . This coordination ensures that NADH production through the TCA cycle is balanced with NADH oxidation capacity through Complex I.

  • Adaptation to gut environment: The ability to adjust TCA cycle flux and respiratory chain activity is essential for C. curvus to colonize the human gastrointestinal tract, which presents variable oxygen concentrations and nutrient availability.

How does the structure and function of nuoK in C. curvus potentially differ from that in other bacterial species?

While specific structural information about C. curvus nuoK is limited, we can make informed comparisons based on what is known about Campylobacter biology:

  • Sequence adaptations: The nuoK sequence in C. curvus likely contains adaptations that optimize its function in microaerobic environments. These adaptations may affect hydrophobic domains involved in quinone binding or residues participating in proton translocation.

  • Proton pumping efficiency: As a microaerophilic organism adapted to environments with variable oxygen tension, C. curvus might possess a nuoK subunit optimized for higher proton-pumping efficiency at low electron flux, compensating for limited terminal electron acceptor availability.

  • Interaction with alternative electron carriers: The nuoK subunit may have evolved specific interaction surfaces to accommodate electron carriers utilized in C. curvus's distinctive metabolic pathways, potentially including components involved in the rHURM pathway .

  • Oxygen sensitivity: Unlike obligate anaerobes or aerobes, microaerophilic organisms like C. curvus must maintain respiratory function across a narrow range of oxygen concentrations. This likely affects the redox sensitivity of Complex I components, including nuoK.

  • Temperature adaptation: C. curvus grows at both 35°C and 42°C , suggesting that its nuoK structure maintains stability and function across this temperature range, which may involve specific adaptations in transmembrane domain packing.

What role might nuoK play in C. curvus virulence and host colonization?

The role of nuoK in C. curvus virulence and host colonization likely encompasses several aspects:

  • Energy provision during infection: C. curvus has been associated with bloody gastroenteritis and Brainerd's diarrhea . During infection, nuoK's role in energy conversion would be crucial for bacterial survival and replication within the host environment.

  • Adaptation to intestinal oxygen gradients: The human intestinal tract presents varying oxygen gradients. nuoK, as part of Complex I, would be important for adapting to these conditions, similar to how CemR has been shown to help related bacteria adapt their metabolism to changing oxygen availability in the gastrointestinal tract .

  • Resistance to host defenses: Efficient energy production via Complex I might contribute to C. curvus's ability to resist host defense mechanisms, including oxidative stress imposed by immune cells.

  • Metabolic flexibility: The ability to modulate energy production through nuoK and related components likely contributes to C. curvus's ability to persist in the host environment, potentially switching between different nutrient sources and respiratory modes as conditions change.

  • Integration with virulence-associated pathways: Energy metabolism may be coordinated with expression of virulence factors, as has been observed in other bacterial pathogens, making nuoK indirectly important for virulence regulation.

What expression systems are most effective for producing recombinant C. curvus nuoK protein?

Producing recombinant C. curvus nuoK presents several challenges due to its nature as a hydrophobic membrane protein. The following expression systems should be considered:

  • E. coli C41(DE3) or C43(DE3) strains: These strains, derivatives of BL21(DE3), are engineered specifically for membrane protein expression and can tolerate the toxic effects often associated with overexpression of membrane proteins.

  • Campylobacter-derived expression systems: For more native-like protein folding, consider expression in C. jejuni, which shares similar membrane composition and processing machinery with C. curvus. This approach may be particularly valuable for functional studies.

  • Cell-free expression systems: These can be advantageous for membrane proteins, allowing direct incorporation into supplied lipid environments. This approach circumvents toxicity issues and may improve yield for difficult membrane proteins.

  • Fusion protein strategies: Expression as a fusion with solubility-enhancing tags (MBP, SUMO, etc.) followed by specific protease cleavage can improve initial expression, though care must be taken with membrane proteins.

  • Codon optimization: Adapting the C. curvus nuoK sequence to the codon usage of the expression host is particularly important due to the potential for rare codons in Campylobacter that might cause translational stalling in heterologous systems.

The choice of expression system should be guided by the downstream applications, whether structural studies requiring high yield or functional assays requiring proper folding and activity.

What are the optimal conditions for growing C. curvus cultures to study native nuoK expression?

Based on the established characteristics of C. curvus, the following conditions are recommended for studying native nuoK expression:

  • Growth medium: Utilize blood-containing media such as Blood Agar Plates (BAP) or Brucella broth supplemented with 5% sheep blood, which support reliable growth of C. curvus .

  • Microaerobic conditions: Maintain cultures in a microaerobic atmosphere (5% O₂, 10% CO₂, 85% N₂) using commercially available gas packs or a variable atmosphere incubator.

  • Temperature: Culture at 35-37°C, which supports optimal growth of C. curvus . For temperature-dependent expression studies, comparisons can be made with cultures grown at 42°C, another temperature that supports C. curvus growth.

  • Incubation time: Allow for extended incubation periods (>3 days) as C. curvus growth may be slow, especially when adapting to experimental conditions .

  • Oxygen gradient experiments: To study oxygen-dependent regulation of nuoK, consider using gradient plates or tubes where oxygen concentration varies from microaerobic to nearly anaerobic conditions.

  • Growth phase monitoring: Sample cultures at different growth phases (early exponential, late exponential, and stationary) to capture temporal expression patterns of nuoK, as respiratory chain components often show growth phase-dependent regulation.

  • Electron acceptor supplementation: Include experiments with alternative electron acceptors such as fumarate or nitrate, which may affect nuoK expression through respiratory chain regulation .

What purification strategies are recommended for recombinant C. curvus nuoK?

Purifying membrane proteins like nuoK requires specialized approaches:

  • Membrane isolation: Start with careful isolation of membrane fractions using ultracentrifugation, avoiding harsh conditions that might denature the protein.

  • Detergent screening: Test multiple detergents for solubilization efficiency:

    • Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin often retain membrane protein structure and function

    • Consider fluorinated surfactants for particularly challenging cases

    • Nanodiscs or SMALPs (styrene-maleic acid lipid particles) can extract membrane proteins with their native lipid environment

  • Affinity chromatography: Use histidine or other affinity tags positioned to minimize interference with protein folding, typically at the N- or C-terminus based on topology predictions.

  • Size exclusion chromatography: As a final purification step, size exclusion removes aggregates and can provide information about the oligomeric state of nuoK in detergent micelles.

  • Protein stability monitoring: Throughout purification, monitor protein stability using techniques like dynamic light scattering or fluorescence-based thermal shift assays to optimize buffer conditions.

  • Lipid supplementation: Consider adding specific lipids during purification, as Campylobacter membrane proteins may require particular lipid compositions for stability and function.

  • Reducing agent considerations: Include reducing agents (e.g., DTT or TCEP) in purification buffers if nuoK contains cysteine residues that might form inappropriate disulfide bonds during purification.

What techniques are most effective for measuring nuoK activity in vitro?

Assessing nuoK activity is challenging as it functions as part of the larger Complex I. These approaches can provide insights into its role:

  • Reconstitution experiments: Reconstitute purified nuoK with other Complex I components (either purified or in membrane fragments) to restore NADH:quinone oxidoreductase activity.

  • Proton pumping assays: Measure proton translocation using:

    • pH-sensitive fluorescent dyes in proteoliposomes

    • Quenching of acridine orange fluorescence to detect formation of pH gradients

    • Ion-selective electrodes to directly measure pH changes

  • Electron transfer measurements: Monitor electron transfer from NADH to quinones spectrophotometrically:

    • Follow NADH oxidation at 340 nm

    • Track quinone reduction using wavelength-appropriate absorption changes

    • Use oxygen consumption as a downstream readout when coupled to oxygen-reducing terminal oxidases

  • Membrane potential measurements: Utilize voltage-sensitive fluorescent dyes to assess membrane potential generation in proteoliposomes containing reconstituted Complex I with nuoK.

  • Site-directed mutagenesis: Create specific mutations in conserved residues of nuoK to correlate structure with function in activity assays, focusing on residues predicted to be involved in proton translocation.

  • Inhibitor studies: Use specific Complex I inhibitors (e.g., piericidin A, rotenone) and analyze how they affect activity in wild-type versus modified nuoK to understand functional domains.

How can researchers interpret contradictory results in C. curvus nuoK functional studies?

When facing contradictory results in nuoK functional studies, consider these analytical approaches:

  • Experimental condition variations: Systematically examine how differences in growth conditions, especially oxygen levels, affect nuoK function. C. curvus, as a microaerophilic organism, may exhibit different nuoK characteristics depending on precise oxygen tensions.

  • Strain variability analysis: C. curvus strains show phenotypic variations, with 50% being catalase-positive and only 15% indoxyl acetate-positive, despite previous descriptions suggesting different characteristics . These variations might extend to nuoK function and regulation.

  • Multi-method validation: Apply complementary techniques to verify findings:

    • Combine transcriptomic data (RNA-Seq) with proteomic confirmation

    • Validate gene expression results with both microarray and qRT-PCR approaches

    • Compare in vitro findings with in vivo models

  • Integrated pathway analysis: Consider nuoK function in the context of the complete respiratory network. Studies in C. jejuni show that genes like succinate dehydrogenase (sdhA) are highly upregulated (32.11-fold) in vivo , suggesting complex metabolic adaptations that might influence interpretation of nuoK data.

  • Statistical robustness assessment: When analyzing gene expression data for nuoK, apply stringent statistical thresholds similar to those used in C. jejuni studies, which considered >2.0-fold changes in expression significant . Perform regression analysis between different quantification methods to validate findings, as shown in C. jejuni studies where qRT-PCR validated microarray results .

What controls are essential for validating recombinant C. curvus nuoK expression and function?

Essential controls for validating recombinant C. curvus nuoK work include:

  • Expression validation controls:

    • Positive controls: Well-expressed membrane proteins from Campylobacter species

    • Tag-only constructs to distinguish tag artifacts from genuine nuoK properties

    • Wild-type C. curvus membrane preparations as reference for native nuoK

  • Functional assay controls:

    • Known Complex I inhibitors to confirm specificity of measured activities

    • Uncouplers to distinguish proton pumping from electron transfer activities

    • Alternative NADH dehydrogenases as comparators for electron transfer without proton pumping

  • Specificity controls:

    • Site-directed mutants of key residues predicted to be essential for nuoK function

    • Heterologous nuoK subunits from related organisms to assess species-specific functions

    • Complementation experiments in nuoK-deficient strains to confirm functional restoration

  • Environmental variation controls:

    • Parallel experiments at different oxygen tensions to capture environment-dependent functions

    • pH and temperature variation series to establish optimum conditions and physiological range

    • Alternative electron acceptor supplementation to assess respiratory flexibility

  • Technical controls:

    • Multiple detergent conditions to distinguish genuine protein properties from solubilization artifacts

    • Different membrane mimetic systems (nanodiscs, liposomes) to validate activities in near-native environments

    • Time-course measurements to distinguish initial rates from secondary effects

How can researchers distinguish between direct effects of nuoK mutations and polar effects on adjacent genes?

Distinguishing direct from polar effects requires multiple complementary approaches:

  • Complementation strategies:

    • In-trans complementation with wild-type nuoK under control of an inducible promoter

    • Site-specific chromosomal restoration of nuoK while maintaining mutations in adjacent regions

    • Partial operon complementation to restore potential polar effects

  • Transcriptional analysis:

    • RT-PCR targeting genes up- and downstream of nuoK to detect expression changes

    • RNA-Seq to comprehensively assess transcriptional landscape around nuoK

    • Promoter-reporter fusions to directly measure transcriptional activity of potentially affected genes

  • Protein expression verification:

    • Western blot analysis of proteins encoded by genes adjacent to nuoK

    • Targeted proteomics approaches to quantify levels of potentially affected proteins

    • Activity assays for enzymes encoded by genes in the same operon as nuoK

  • Genetic construction controls:

    • Creation of in-frame deletions that minimize polar effects

    • Introduction of premature stop codons that preserve mRNA structure but eliminate protein function

    • Construction of multiple independent mutants with different genetic strategies to confirm phenotypic consistency

  • Metabolic profiling:

    • Comparative metabolomics between wild-type, nuoK mutant, and complemented strains

    • Isotope labeling studies to track specific metabolic pathways potentially affected

    • Respiratory chain component analysis to assess complex assembly and function

What reference genes are recommended for qRT-PCR studies of nuoK expression in C. curvus?

Selecting appropriate reference genes is crucial for accurate qRT-PCR analysis:

  • Validated reference genes for Campylobacter:

    • rpoA (RNA polymerase subunit alpha): Shows stable expression in Campylobacter across various conditions

    • 16S rRNA: Traditional reference, though multiple copies in Campylobacter (three copies of 23S rRNA genes are present ) necessitate careful primer design

    • gyrA: DNA gyrase subunit A maintains relatively stable expression across growth conditions

  • Validation approach for reference genes:

    • Test multiple candidate reference genes under experimental conditions

    • Apply algorithms like geNorm, NormFinder, or BestKeeper to identify the most stable references

    • Use at least two reference genes for normalization to improve reliability

  • Experimental considerations:

    • Include reference gene validation under the specific conditions being tested (oxygen limitation, different growth phases, etc.)

    • Verify reference gene stability in both in vitro and in vivo conditions if applicable

    • Consider using different reference genes for dramatically different experimental conditions

  • Technical validation:

    • Perform efficiency calculations for all primer pairs, including reference genes

    • Ensure similar amplification efficiencies between target and reference genes

    • Include no-RT controls to detect genomic DNA contamination

  • Data analysis recommendations:

    • Apply the 2^(-ΔΔCt) method with efficiency correction when using validated reference genes

    • Report both raw Ct values and normalized expression data for transparency

    • Include statistical analysis of reference gene stability across experimental conditions

How might understanding C. curvus nuoK contribute to developing novel antimicrobial strategies?

The study of C. curvus nuoK could inform antimicrobial development in several ways:

  • Targeted inhibition: Complex I is essential for energy metabolism in many bacteria. Structural and functional insights into C. curvus nuoK could reveal unique features that might be exploited for selective inhibition, particularly if these features differ from human mitochondrial Complex I.

  • Biofilm disruption: If nuoK function is important for maintaining energy levels during biofilm formation, inhibitors could potentially disrupt this process, making C. curvus more susceptible to conventional antibiotics.

  • Host colonization interference: Understanding how nuoK contributes to adaptation to the human gut environment could reveal strategies to prevent colonization, particularly important given C. curvus's association with bloody gastroenteritis and Brainerd's diarrhea .

  • Combination therapies: Targeting energy metabolism via nuoK inhibition might sensitize C. curvus to antibiotics that are currently showing reduced efficacy due to developing resistance, as noted in Campylobacter species .

  • Metabolic vulnerability identification: Detailed understanding of how nuoK function integrates with the rHURM pathway and other C. curvus-specific metabolic features could reveal unique metabolic vulnerabilities that might be targeted therapeutically.

What role might nuoK play in C. curvus adaptation to different environmental niches?

The nuoK subunit likely contributes to C. curvus environmental adaptation in multiple ways:

  • Oxygen gradient navigation: As part of Complex I, nuoK would help C. curvus generate energy across the oxygen gradients encountered in the human gut and other environments. This is particularly important given that Campylobacteria face "variable atmospheric environments during infection and transmission, ranging from nearly anaerobic to aerobic conditions" .

  • Metabolic flexibility: nuoK may contribute to the ability of C. curvus to utilize different electron donors and acceptors depending on environmental conditions, similar to how C. jejuni can use fumarate as an alternative electron acceptor under oxygen-limited conditions .

  • Stress response: Energy generation via Complex I would support cellular responses to environmental stresses, providing ATP for stress-response proteins and membrane transporters involved in maintaining homeostasis.

  • Temperature adaptation: C. curvus can grow at both 35°C and 42°C , suggesting temperature-adaptive features in its energy metabolism machinery, potentially including structural adaptations in membrane proteins like nuoK.

  • Host-pathogen interactions: The ability to maintain energy production in the face of host defense mechanisms would depend partly on nuoK function, contributing to C. curvus's ability to persist in host tissues despite immune responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.