Recombinant Campylobacter curvus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock
Cat. No.
BT2144261
Source
in vitro E.coli expression system
Synonyms
lgt; Ccur92_14050; CCV52592_2203; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Quick Inquiry

Description

Functional Role in Bacterial Physiology

Lgt is indispensable in Gram-negative bacteria for lipoprotein biogenesis:

  • Mechanism: Transfers diacylglyceryl groups to prolipoproteins, forming thioether bonds critical for membrane anchoring .

  • Essentiality: Depletion of Lgt disrupts outer membrane integrity, increasing susceptibility to antibiotics and serum killing in pathogens like E. coli and Acinetobacter baumannii .

  • Pathogenicity Link: In Campylobacter species, lipoproteins contribute to virulence factors such as host-cell adhesion and immune evasion .

Antibacterial Target Validation

  • Inhibitors targeting Lgt (e.g., compounds G9066, G2823) show potent activity (IC<sub>50</sub> values ≤0.93 μM) in biochemical assays, disrupting lipoprotein maturation .

  • Unlike downstream lipoprotein pathway inhibitors, Lgt-targeted compounds remain effective even in lpp-deficient strains, reducing resistance risks .

References

  1. Cusabio. (n.d.). Recombinant Campylobacter curvus Prolipoprotein diacylglyceryl transferase (lgt). Retrieved from Cusabio

  2. PMC. (2020). Novel inhibitors of E. coli lipoprotein diacylglyceryl transferase. PMC Article

  3. PMC. (2012). Comparative characterization of virulence gene clusters in Campylobacter. PMC Article

  4. MyBioSource. (n.d.). Recombinant Prolipoprotein diacylglyceryl transferase. Retrieved from MyBioSource

  5. PMC. (2022). A defect in lipoprotein modification by Lgt leads to abnormal morphology. PMC Article

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and inherent protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
lgt; Ccur92_14050; CCV52592_2203; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Campylobacter curvus (strain 525.92)
Target Names
lgt
Target Protein Sequence
MSTWNDIYNHFDPVAFTLFGFSVHWYGIMYILALLSALGAAKYFVKKDNIPITDALLDNY FFWVEIGVILGARLGYIAIYSGEAVYFFTHPWQIFNPFHNGEFVGIRGMSYHGAVVGFLL ATILFCKKYKQNLWQLLDLCALCIPFGYIFGRIGNFLNQELFGRATDVSWGINVFGILRH PSQLYEAALEGLAVFLILFFYRKFKKFDGELIALYAVLYTLARFVCEFFREPDAGIGFII FGLSMGQILSILMFFGGILAYFFLKKNYIK
Uniprot No.
A7GZR7

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: ccv:CCV52592_2203

STRING: 360105.CCV52592_2203

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.