Recombinant Campylobacter curvus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Campylobacter curvus Protease HtpX homolog (htpX) is a metalloprotease expressed in Escherichia coli for biochemical and immunological studies. Key features include:

PropertyDetail
UniProt IDA7GZM4
Gene NamehtpX
Expression SystemEscherichia coli
TagN-terminal His tag (determined during production)
Sequence Length286 amino acids (full-length)
Molecular FunctionMetalloprotease activity (EC 3.4.24.-)
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C for stability
Source:

Expression and Purification

Recombinant HtpX is produced in E. coli with the following protocols:

  1. Vector: pET-based plasmid for high-yield expression.

  2. Purification: Affinity chromatography via His tag, followed by buffer exchange into Tris-glycerol solutions.

  3. Yield: 50 µg standard quantity, scalable to custom orders .

Protease Activity

  • Substrate Specificity: Metalloproteases like HtpX typically degrade misfolded proteins under stress conditions.

  • Role in Pathogenesis: C. jejuni HtrA cleaves epithelial tight junction proteins (e.g., claudin-8, occludin), enabling bacterial transmigration .

Genetic Context

  • Genomic Localization: In C. curvus, htpX is located near the pgl operon (protein glycosylation genes), suggesting a role in post-translational modification or stress response .

Research Applications

  1. Drug Development: Target for protease inhibitors to combat Campylobacter infections.

  2. Host-Pathogen Interaction Studies: Investigate HtpX’s role in disrupting intestinal barriers.

  3. Structural Biology: Study zinc-dependent catalytic mechanisms via mutagenesis .

Research Gaps and Future Directions

  • Functional Characterization: Direct evidence of HtpX’s substrates and regulatory mechanisms in C. curvus is lacking.

  • Therapeutic Potential: No inhibitors targeting HtpX have been reported, unlike C. jejuni HtrA .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
htpX; Ccur92_13620; CCV52592_1342; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Campylobacter curvus (strain 525.92)
Target Names
htpX
Target Protein Sequence
MEIFKTCFLMVVLMLLFVFVGGYVGGQQGMIIAFLVALGMNFFSYFFSDKLVLKRYNAVE VSKKNAKGLYAIVRRLSQNAGLPMPKVYIIPERAPNAFATGRNPSHAAVAVTEGLLNLLN ENEIEGVLAHELSHVRHYDILTGSIAAVMAGAIAMLANFAKFGAASGSNRNTQKGNAAIM LIIALIMPLAATIIQMAISREREYKADKGAALLTGHPEWLESALNKLENYSNSYTMQNAS PQSAHMFIINPFGDIKNTLSTLFRTHPSTSDRIAELKKIGMQLKNR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the HtpX protease and what is its function in Campylobacter species?

HtpX is an M48 family zinc metalloproteinase located in the cytoplasmic membrane of bacteria, including Campylobacter species. Based on studies in model organisms like E. coli, HtpX is primarily involved in the quality control of membrane proteins, eliminating malfolded and/or misassembled membrane proteins that could potentially disturb the structure and function of biological membranes . In Campylobacter species, membrane proteases contribute significantly to bacterial survival under stress conditions and may play important roles in pathogenesis, similar to other proteases like HtrA that have been implicated in virulence .

How does the structure of HtpX in C. curvus compare to that in E. coli?

The HtpX protease in E. coli contains four hydrophobic regions (H1-H4) that potentially function as transmembrane segments, although there is controversy regarding whether the two C-terminal regions are embedded in the membrane . While specific structural data for C. curvus HtpX homolog is limited in the current literature, it likely shares similar structural features as an M48 family zinc metalloproteinase. Researchers should note that despite probable structural similarities, species-specific variations may exist that affect substrate specificity and enzymatic activity.

What are the typical expression systems used for producing recombinant Campylobacter proteins?

Recombinant Campylobacter proteins, including those from C. curvus, are commonly expressed using several systems:

  • E. coli expression systems (most common)

  • Yeast expression systems

  • Baculovirus expression systems

  • Mammalian cell expression systems

Each system offers different advantages in terms of protein folding, post-translational modifications, and yield. For membrane proteins like HtpX, E. coli systems are often used first due to their simplicity and cost-effectiveness, though proper folding of complex membrane proteins sometimes requires eukaryotic expression systems.

What is the recommended protocol for assessing the proteolytic activity of recombinant HtpX?

To assess the proteolytic activity of recombinant HtpX from C. curvus, researchers can adapt the in vivo protease activity assay developed for E. coli HtpX. This system employs a model substrate designed to allow sensitive detection of protease activity. The methodology involves:

  • Construction of a model substrate (similar to the XMS1 substrate used for E. coli HtpX)

  • Expression of both the recombinant HtpX and the model substrate

  • Detection of proteolytic cleavage products using immunoblotting techniques

  • Quantification of cleaved fragments to assess proteolytic activity

This system enables semiquantitative and convenient measurement of protease activity and can detect differential activities of HtpX variants carrying mutations in conserved regions.

How can researchers effectively solubilize and purify HtpX as a membrane protein?

As a membrane protein, HtpX presents challenges for solubilization and purification. A methodological approach includes:

  • Expression with appropriate tags (His6, His10, or His6-Myc tags have been successfully used for HtpX)

  • Membrane fraction isolation through differential centrifugation

  • Membrane solubilization using detergents (common options include n-dodecyl β-D-maltoside or digitonin)

  • Affinity chromatography using the introduced tags

  • Size exclusion chromatography for further purification

When selecting detergents, consider those that maintain protein stability and activity while effectively solubilizing the membrane protein.

What are the optimal conditions for preserving HtpX activity during purification and storage?

To maintain optimal activity of purified recombinant HtpX:

  • Include zinc or other divalent metal ions in purification buffers to preserve metalloprotease activity

  • Maintain pH in the range of 7.0-8.0 throughout purification

  • Include reducing agents to prevent oxidation of critical cysteine residues

  • Store purified protein with glycerol (20-25%) at -80°C

  • Avoid repeated freeze-thaw cycles

  • Consider storage in small aliquots to minimize activity loss

How can mutational analysis be used to investigate the substrate specificity of C. curvus HtpX?

Mutational analysis provides valuable insights into HtpX substrate specificity and catalytic mechanisms. A comprehensive approach includes:

  • Identification and mutation of conserved residues in the predicted catalytic domain

  • Creation of chimeric proteins combining domains from HtpX homologs of different species

  • Assessment of each mutant's activity using standardized substrates

  • Correlation of structural changes with altered substrate preference

When designing mutations, researchers should focus on residues in the predicted active site and substrate-binding pocket based on structural homology with better-characterized M48 family proteases. The established in vivo protease activity assay system allows detection of differential activities of these HtpX mutants .

What is known about the role of HtpX in Campylobacter stress response and environmental persistence?

While specific data on HtpX in C. curvus is limited, research on other proteases in Campylobacter species suggests important roles in stress response. For example, the stress response proteases HtrA and HtrB have been associated with:

  • Increased tolerance to oxygen

  • Resistance to thermal shock

  • Adaptation to pH changes

  • Response to osmotic stress

  • Environmental persistence during processing

The prevalence of stress response genes like htrA and htrB increases significantly in Campylobacter isolates after processing at abattoirs, suggesting selection for stress-resistant strains, as shown in the table below:

GeneInitial product (Positive)Final product (Positive)p-value
htrA9/44 (20.5%)39/75 (52.0%)0.001
htrB37/44 (84.1%)74/75 (98.7%)0.002
ppk132/44 (72.7%)50/75 (66.7%)0.491

This data suggests that stress response proteases confer a significant survival advantage . Similar studies focusing specifically on HtpX would be valuable for understanding its role in C. curvus persistence.

How might HtpX interact with other proteolytic systems in Campylobacter species?

Proteases in Campylobacter rarely function in isolation. Research suggests potential interactions between different proteolytic systems:

  • HtpX may function cooperatively with other membrane proteases like FtsH in quality control of membrane proteins

  • Multiple proteases may have overlapping substrate specificities, providing redundancy

  • Regulatory interactions might exist where one protease can influence the expression or activity of another

Studies in C. jejuni have shown that several proteases, including serine proteases HtrA and Cj0511, contribute to virulence and are found in outer membrane vesicles (OMVs) . Similar interactions may exist for HtpX in C. curvus, suggesting a complex proteolytic network worthy of investigation.

What approaches can overcome difficulties in expressing functional recombinant HtpX?

Researchers frequently encounter challenges when expressing membrane proteases like HtpX. Effective strategies include:

  • Optimization of expression conditions (temperature, inducer concentration, duration)

  • Co-expression with chaperones to assist proper folding

  • Fusion with solubility-enhancing tags (MBP, SUMO, TrxA)

  • Cell-free expression systems for difficult-to-express variants

  • Expression of truncated versions containing only the catalytic domain

For functional assessment, implementing the in vivo protease activity assay system allows detection of even low levels of proteolytic activity, making it possible to evaluate constructs with suboptimal expression .

How can researchers differentiate between the functions of HtpX and other proteases in Campylobacter species?

Differentiation between the specific functions of HtpX and other proteases requires:

  • Generation of specific knockout mutants for htpX and other proteases

  • Construction of double/multiple knockout strains to identify functional redundancy

  • Complementation studies with wild-type and mutant variants

  • Substrate profiling to identify unique and overlapping targets

  • Comparative stress response assays to determine condition-specific roles

Research on C. jejuni proteases has demonstrated that deletion of genes encoding proteases like htrA, cj0511, or cj1365c reduces proteolytic activity in outer membrane vesicles, indicating their distinct contributions to bacterial proteolytic capacity .

What techniques are most effective for identifying physiological substrates of HtpX in C. curvus?

Identifying the physiological substrates of HtpX remains a significant challenge. Recommended approaches include:

  • Proteomics comparison of wild-type and htpX knockout strains under different stress conditions

  • Substrate trapping using catalytically inactive HtpX variants

  • Crosslinking coupled with mass spectrometry to capture transient enzyme-substrate interactions

  • Bioinformatic prediction of substrates based on known cleavage sites of homologous proteases

  • In vitro degradation assays with candidate substrate proteins

These approaches can be combined to build a comprehensive understanding of HtpX substrates in C. curvus, similar to efforts in characterizing the substrate profiles of proteases in other bacteria.

How might understanding HtpX function contribute to novel antimicrobial strategies against Campylobacter?

The potential of HtpX as a target for antimicrobial development rests on several factors:

  • If HtpX plays essential roles in stress survival and pathogenesis, inhibitors could reduce bacterial persistence

  • The unique structure of bacterial M48 proteases might allow for selective targeting without affecting host proteases

  • Inhibitors that synergize with existing antibiotics could help overcome resistance

Research should focus on validating HtpX as an essential protein under relevant conditions, such as during host colonization or environmental persistence, before pursuing it as an antimicrobial target.

What comparative genomics approaches would be valuable for understanding HtpX evolution across Campylobacter species?

Comparative genomics offers insights into the evolutionary significance of HtpX:

  • Phylogenetic analysis of HtpX sequences across Campylobacter species to identify conserved and variable regions

  • Correlation of genetic variations with pathogenicity or host specificity

  • Assessment of selective pressure on different regions of the protein

  • Identification of horizontal gene transfer events that might have influenced htpX evolution

  • Comparison with HtpX homologs in more distantly related pathogens

Such analyses could reveal whether HtpX function has diversified across Campylobacter species, including C. curvus, and might identify species-specific features relevant to pathogenesis.

How does the role of HtpX in C. curvus compare to its function in other gastrointestinal pathogens?

Comparative functional studies of HtpX across gastrointestinal pathogens would provide valuable context:

  • Construct phylogenetic relationship maps of HtpX homologs across pathogenic bacteria

  • Compare substrate specificities between HtpX from different species

  • Assess the contribution of HtpX to virulence in various infection models

  • Determine if HtpX function is conserved or has evolved specialized roles in different bacteria

  • Investigate whether HtpX contributes differently to persistence in foodborne versus environmental transmission routes

Such comparative studies would place C. curvus HtpX in a broader evolutionary and functional context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.