Recombinant Campylobacter fetus subsp. fetus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant ATP Synthase Subunit a (atpB)

Gene and Protein Structure

  • Encoded by the atpB gene (locus tag: CFF8240_0771), this subunit is part of the F0 sector of the ATP synthase complex, which drives ATP synthesis via proton translocation .

  • The recombinant protein spans 226 amino acids (UniProt ID: A0RP13) and includes an N-terminal His tag for purification .

Functional Role

  • Essential for oxidative phosphorylation: Facilitates proton transport across the membrane, enabling ATP synthesis .

  • Structural analyses reveal conserved transmembrane helices critical for interactions with other F0 subunits (e.g., subunit c) .

Production and Purification

Expression System

  • Produced in Escherichia coli using plasmid vectors optimized for Campylobacter-specific codon usage .

  • Purification involves immobilized metal affinity chromatography (IMAC) via the His tag, yielding >90% purity .

Antigenic Studies

  • Used in ELISA to detect C. fetus-specific antibodies in clinical samples .

  • Immunogenicity studies suggest potential as a diagnostic marker for bovine and human infections .

Functional Genomics

  • Proteomic analyses (e.g., LFQ-MS) reveal altered expression in C. fetus glycosylation mutants, linking ATP synthase activity to hydrogenase regulation and nickel homeostasis .

  • Comparative genomics identifies atpB as a stable genetic marker for subspecies differentiation (e.g., C. fetus subsp. fetus vs. venerealis) .

Genomic and Phenotypic Correlations

Subspecies-Specific Features

  • atpB is conserved across C. fetus subspecies but exhibits transcriptional differences in niche-adapted strains .

  • In C. fetus subsp. venerealis, ATP synthase activity correlates with enhanced virulence gene expression via a type IV secretion system (T4SS) .

Antimicrobial Resistance (AMR)

  • No direct AMR linkage reported, but C. fetus subsp. fetus harbors plasmid-borne resistance genes (e.g., tet(O), aph(3')-III) .

  • Recombinant atpB serves as a control in studies assessing AMR-related metabolic shifts .

Future Directions

  • Vaccine Development: Investigate atpB as a subunit vaccine target due to surface exposure in C. fetus .

  • Structural Biology: Cryo-EM studies to resolve proton channel mechanics in the F0 sector .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
atpB; CFF8240_0771; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Campylobacter fetus subsp. fetus (strain 82-40)
Target Names
atpB
Target Protein Sequence
MKELFLFSDMIMHSHTFNYLFHLILVAIIVLIVAKLATRSMQLVPRGSQNLLEAYLEGIV SMGRDVMGSDELARKYLPLVATIGLIVLTSNVIGIIPGFEAPSSSLNLTLCLALSVFLYY NFEGIRTQGIIKYFAHFMGPNKILAPLMFPIEIVSHLSRIVSLSFRLFGNIKGDDLFLMV VLSLAPWVAPLPAFALLTFMALLQTFIFMILTYVYLAGAVVVSEEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel and plays a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.