Recombinant Campylobacter fetus subsp. fetus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Biological Role in Campylobacter fetus

NuoK is a membrane-bound subunit of Complex I, which transfers electrons from NADH to ubiquinone during oxidative phosphorylation. Unlike other bacteria, Campylobacter spp. lack nuoE and nuoF genes encoding NADH dehydrogenase modules, suggesting evolutionary adaptations in electron donor usage . Key findings:

  • Electron Transport: In C. jejuni (a related species), Complex I accepts electrons from flavodoxin instead of NADH, mediated by novel genes (Cj1574c/Cj1575c) replacing nuoE/F .

  • Essentiality: Disruption of nuo genes in C. jejuni abolishes growth in amino acid-based media unless supplemented with formate or hydrogen .

3.1. Functional Studies

  • Respiratory Pathways: Used to investigate electron transport chain adaptations in Campylobacter spp., particularly flavodoxin-dependent respiration .

  • Gene Essentiality: Targeted mutagenesis of nuoK helps elucidate its role in bacterial viability and metabolism .

Comparative Analysis with Related Species

FeatureC. fetus subsp. fetus nuoKMycobacterium nuoK (Q73V05)
Length102 residues99 residues
Sequence HomologyUnique N-terminal hydrophobic domainLacks analogous motif
Expression HostE. coliE. coli
Key ResiduesConserved transmembrane helicesDivergent Fe-S cluster binding sites

Technical Considerations

  • Mutagenesis Challenges: nuoK deletion mutants require alternative electron donors (e.g., formate) for growth, complicating phenotypic studies .

  • Flavodoxin Dependency: In C. jejuni, flavodoxin serves as the electron acceptor for α-ketoglutarate oxidoreductase, linking nuoK to central carbon metabolism .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Please indicate any preferred format in your order remarks, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point for your adjustments.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; CFF8240_0166; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Campylobacter fetus subsp. fetus (strain 82-40)
Target Names
nuoK
Target Protein Sequence
MLDFYILVALILFFIGVLGVILRKNIFTIFMSVELMLNATALIFATFARQSLNLDGQVIV MLIIAIAAAEASFGLALIVLLYKKKQSLNIDIFDELKDRDVS
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of NADH-quinone oxidoreductase (complex I) in Campylobacter fetus?

Campylobacter fetus complex I is a respiratory enzyme that differs significantly from conventional bacterial complex I systems. Based on genomic analysis, C. fetus subsp. fetus contains a complete set of nuo genes encoding the NADH:ubiquinone oxidoreductase (complex I) subunits . The complex comprises a membrane domain (including the nuoK subunit) and a peripheral arm that extends into the cytoplasm.

Unlike standard bacterial complex I which oxidizes NADH, research on the closely related C. jejuni indicates that Campylobacter species have adapted their complex I to utilize flavodoxin rather than NADH as the primary electron donor . This adaptation represents a significant evolutionary modification in the respiratory chain that may be conserved across Campylobacter species.

Table 1: Nuo Cluster Organization in Campylobacter Species

SpeciesNuo Cluster TypeSubunit Organization
C. fetus subsp. venerealisType InuoA-nuoB-nuoCD-nuoE-nuoF-nuoG-nuoH-nuoI-nuoJ-nuoK-nuoL-nuoM-nuoN
C. lari subsp. concheusType IInuoA-nuoB-nuoC-nuoD-ORF-ORF-nuoG-nuoH-nuoI-nuoJ-nuoK-nuoL-nuoM-nuoN
C. sputorum bv. sputorumType IIInuoA-nuoB-nuoC-nuoD-nuoE-nuoF-nuoG-nuoH-nuoI-nuoJ-nuoK-nuoL-nuoM-nuoN

Data adapted from genomic analysis of Campylobacter species .

How does nuoK contribute to the membrane domain of complex I in C. fetus?

The nuoK subunit is an integral component of the membrane domain of complex I in C. fetus. Based on structural studies of complex I in other organisms, nuoK is predicted to contain three transmembrane helices that contribute to the proton-translocating machinery of the enzyme.

In C. fetus, as in other bacteria, nuoK likely plays a crucial role in maintaining the structural integrity of the membrane domain and participates in the proton translocation pathway that couples electron transfer to proton pumping across the membrane. The stability of the entire complex I likely depends on proper integration of nuoK into the membrane domain assembly .

The high genetic stability observed across C. fetus subspecies suggests that critical respiratory components like nuoK are conserved due to their essential functions .

What expression systems are optimal for recombinant production of C. fetus nuoK protein?

Expression of recombinant C. fetus nuoK presents significant challenges due to its hydrophobic nature as a membrane protein. Based on successful expression of other Campylobacter proteins, the following approaches are recommended:

  • Heterologous Expression in E. coli:

    • Utilize specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Expression vectors should include a strong C. fetus promoter rather than standard E. coli promoters to enhance expression

    • The addition of fusion tags (His6, MBP, or SUMO) at the N-terminus improves protein solubility and facilitates purification

  • Expression Temperature and Induction Conditions:

    • Lower temperatures (15-17°C) after induction with reduced IPTG concentration (0.1-0.5 mM) significantly improves functional protein yield

  • Buffer Supplementation:

    • Addition of glycerol (5-50%) to the expression media and purification buffers enhances stability

Experiments have shown that E. coli-Campylobacter shuttle vector systems can be employed for expression studies, provided they incorporate C. fetus-specific promoter elements .

What are effective purification strategies for recombinant nuoK protein?

Purification of nuoK requires specialized approaches due to its membrane-integrated nature:

  • Membrane Fraction Isolation:

    • Carefully isolate membrane fractions using ultracentrifugation (100,000 × g for 1 hour)

    • Solubilize membranes with mild detergents (DDM, LMNG, or digitonin at 1-2% w/v)

  • Chromatography Sequence:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography for further purification if necessary

  • Buffer Optimization:

    • Maintain detergent concentration above CMC throughout purification

    • Include 10-15% glycerol and reducing agents (1-5 mM β-mercaptoethanol or DTT)

    • pH maintenance between 7.0-8.0 in moderately buffered solutions (20-50 mM)

Researchers have successfully maintained stability of other Campylobacter membrane proteins by including phospholipids in purification buffers to create a native-like environment .

How can researchers study electron transport mechanisms in C. fetus complex I using recombinant nuoK?

Investigating the electron transport mechanisms in C. fetus complex I requires specialized approaches:

  • Reconstitution Experiments:

    • Reconstitute purified recombinant nuoK with other complex I subunits in liposomes

    • Measure proton translocation activity using pH-sensitive fluorescent dyes (ACMA or pyranine)

    • Evaluate electron transfer using artificial electron donors/acceptors

  • Site-Directed Mutagenesis Studies:

    • Target conserved residues in nuoK predicted to be involved in proton translocation

    • Analyze effects on complex I assembly and activity

    • Compare with known mutations in other organisms

  • Flavodoxin Interaction Analysis:

    • Given that C. jejuni complex I utilizes flavodoxin rather than NADH, explore whether this adaptation is conserved in C. fetus

    • Use surface plasmon resonance or isothermal titration calorimetry to measure binding interactions

Research on C. jejuni has shown that complex I accepts electrons from flavodoxin rather than NADH, with flavodoxin serving as the electron acceptor for the 2-oxoglutarate:acceptor oxidoreductase enzyme . Similar mechanisms likely exist in C. fetus given their evolutionary relationship.

What methods are effective for studying nuoK's role in complex I assembly?

To investigate nuoK's role in complex I assembly:

  • In Vivo Assembly Studies:

    • Create nuoK deletion mutants with complementation constructs

    • Analyze complex I assembly using blue native PAGE

    • Utilize fluorescently tagged subunits to track assembly intermediates

  • Protein-Protein Interaction Analysis:

    • Employ chemical cross-linking followed by mass spectrometry to identify interaction partners

    • Use bacterial two-hybrid systems adapted for membrane proteins

    • Perform co-immunoprecipitation with antibodies against nuoK or tagged versions

  • Cryo-EM Structural Analysis:

    • Purify intact complex I with and without nuoK to compare structural differences

    • Focus on the membrane domain architecture and potential conformational changes

Studies in C. jejuni have demonstrated that complex I mutants lacking key subunits fail to grow in amino acid-based media unless supplemented with alternative respiratory substrates such as formate . Similar phenotypic assays could provide insights into nuoK function in C. fetus.

What are the challenges in distinguishing complex I function between C. fetus subspecies?

Investigating complex I differences between C. fetus subspecies presents several challenges:

  • Genetic Similarity Challenges:

    • C. fetus subspecies share high genomic similarity, with relatively few distinguishing SNPs

    • Whole-genome comparison shows that subspecies maintain core genomic features while differing in accessory elements

    • Precisely attributing functional differences to specific genetic variations requires extensive analysis

  • Methodological Approaches:

    • Comparative proteomics using MALDI-TOF MS can differentiate subspecies-specific protein expression patterns

    • SNP analysis focusing on genes in shared metabolic pathways may reveal subtle differences

    • Transcriptomic analysis can identify differential expression of nuo genes between subspecies

  • Experimental Design Considerations:

    • Ensure consistent growth conditions across subspecies comparison experiments

    • Account for host adaptation differences (e.g., C. fetus subsp. venerealis is primarily adapted to cattle reproductive tract)

    • Develop subspecies-specific genetic tools to enable targeted manipulation

Recent whole-genome comparison studies have identified SNPs between C. fetus subspecies that may affect metabolic functions, though specific impacts on respiratory chains remain under investigation .

How can researchers overcome expression challenges for membrane-associated complex I subunits like nuoK?

Membrane protein expression presents specific challenges that can be addressed through:

  • Fusion Partner Optimization:

    • Test multiple fusion partners (MBP, SUMO, Trx, GST) to identify optimal solubility enhancement

    • Position tags at N-terminus to avoid interfering with membrane integration

    • Consider dual tagging approaches for enhanced purification strategies

  • Expression Host Selection:

    • C. jejuni expression systems may provide more native-like environment for C. fetus proteins

    • Specialized E. coli strains with altered membrane composition can improve yield

    • Cell-free expression systems with supplied lipids offer an alternative approach

  • Co-expression Strategies:

    • Co-express nuoK with adjacent complex I subunits to promote proper folding

    • Include chaperone co-expression plasmids to assist membrane protein folding

    • Provide essential interacting partners to stabilize the target protein

How does nuoK contribute to C. fetus pathogenesis and host adaptation?

The potential role of nuoK in C. fetus pathogenesis involves several research avenues:

  • Metabolism-Virulence Connection:

    • Complex I function affects bacterial energy metabolism, potentially influencing virulence

    • C. fetus causes severe systemic infections in immunocompromised hosts, requiring adaptive metabolism

    • Investigate whether nuoK mutations affect colonization efficiency in different host environments

  • Host-Specific Adaptations:

    • C. fetus subspecies show distinct host preferences (C. fetus subsp. venerealis is primarily found in cattle)

    • Analyze whether nuoK sequence or expression differences correlate with host adaptation

    • Determine if nuoK interacts with host factors during infection

  • Stress Response Role:

    • Respiratory chain components may contribute to stress resistance

    • Examine whether nuoK contributes to microaerophilic growth and oxidative stress tolerance

    • Test if nuoK is involved in adaptation to the variable oxygen concentrations encountered during infection

Research on C. jejuni has demonstrated that complex I mutants show significant colonization deficiencies in host models, suggesting respiratory chain components are critical virulence factors . Similar mechanisms likely apply to C. fetus.

What structural and functional insights can be gained from comparative analysis of nuoK across Campylobacter species?

Comparative analysis of nuoK provides valuable insights:

  • Evolutionary Conservation Analysis:

    • Compare nuoK sequences across Campylobacter species to identify conserved functional domains

    • Map conservation patterns onto structural models to identify critical regions

    • Correlate sequence variations with ecological niches and host ranges

  • Functional Adaptation Studies:

    • Investigate whether nuoK in C. fetus interacts with flavodoxin as observed in C. jejuni

    • Determine if subspecies-specific variations in nuoK affect quinone binding or proton translocation

    • Analyze how nuoK sequence differences might contribute to metabolic adaptations

  • Structural Biology Approaches:

    • Generate homology models based on bacterial complex I structures

    • Use computational simulations to predict impacts of C. fetus-specific residues

    • Perform directed evolution experiments to identify functional constraints

Research on C. jejuni has revealed that its complex I functions with flavodoxin rather than NADH as the electron donor . This unique adaptation might be shared by C. fetus given their phylogenetic relationship, representing a significant evolutionary modification in respiratory metabolism.

Table 2: Comparison of Complex I Characteristics Across Selected Campylobacter Species

SpeciesElectron DonornuoK PresentGrowth RequirementsPathogenicity Association
C. fetus subsp. fetusPredicted flavodoxin*YesMicroaerophilicSystemic infections, bacteremia
C. jejuniFlavodoxinYesMicroaerophilicIntestinal illness, Guillain-Barré syndrome
C. fetus subsp. venerealisPredicted flavodoxin*YesMicroaerophilicBovine reproductive tract infections

*Based on inference from C. jejuni research and evolutionary relationship, requires experimental confirmation.

How can recombinant nuoK be used to develop novel antimicrobial strategies?

Targeting complex I for antimicrobial development presents several opportunities:

  • Structure-Based Drug Design:

    • Use recombinant nuoK to screen for specific inhibitors of Campylobacter complex I

    • Design peptidomimetics that disrupt nuoK interactions with other complex I subunits

    • Target Campylobacter-specific residues that differ from host mitochondrial complex I

  • Metabolic Vulnerability Exploitation:

    • Investigate whether C. fetus strains with compromised complex I function show increased susceptibility to existing antibiotics

    • Test combination therapies targeting both complex I and alternative respiratory pathways

    • Develop compounds that interfere with flavodoxin-complex I interaction in Campylobacter

  • Host-Targeted Strategies:

    • Examine how host metabolites affect C. fetus complex I function

    • Determine if altering host microenvironments can compromise bacterial respiratory efficiency

    • Develop immunomodulatory approaches targeting C. fetus energy metabolism

The unique adaptation of Campylobacter complex I to use flavodoxin rather than NADH presents a species-specific target for antimicrobial development that would not affect the host's mitochondrial complex I .

What are the most promising techniques for analyzing nuoK protein-protein interactions within the complex I assembly?

Advanced approaches for studying nuoK interactions include:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein interaction surfaces with high resolution

    • Identifies dynamic regions within the protein structure

    • Can be performed in near-native membrane environments

  • Single-Particle Cryo-EM Analysis:

    • Enables visualization of the entire complex I assembly

    • Can capture different conformational states during the catalytic cycle

    • Allows structural comparison between wild-type and mutant complexes

  • Genetic Suppressor Screening:

    • Identify mutations in other complex I subunits that rescue nuoK defects

    • Map functional relationships within the complex

    • Discover unexpected interaction partners

These techniques would build upon current understanding of complex I function in Campylobacter species, where flavodoxin rather than NADH serves as the electron donor , potentially revealing unique interaction networks specific to this bacterial genus.

How might emerging gene editing technologies advance nuoK functional studies in C. fetus?

Emerging gene editing approaches offer new opportunities:

  • CRISPR-Cas9 Applications:

    • Develop CRISPR systems optimized for C. fetus genome editing

    • Create precise point mutations in nuoK to test specific hypotheses

    • Generate conditional knockdown systems to study essential functions

  • Base Editing Technologies:

    • Introduce specific nucleotide changes without double-strand breaks

    • Target conserved residues identified through comparative genomics

    • Create subtle mutations that may affect function without disrupting assembly

  • Single-Cell Analysis Integration:

    • Combine genetic engineering with single-cell phenotyping

    • Analyze heterogeneous responses to nuoK modifications

    • Track real-time metabolic consequences of respiratory chain alterations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.