Recombinant Campylobacter fetus subsp. fetus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
crcB; CFF8240_0950; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Campylobacter fetus subsp. fetus (strain 82-40)
Target Names
crcB
Target Protein Sequence
MSFTTIFYIGFGGALGAILRSFTNGFVSKIFPNLSFPLGTLSVNIIGGFFIGFLMSLASN INIDINLKSFLVTGFLGGLTTFSTFSYENMLLLQSGNYTNAFLNIASNLLLSLLFCYFGF WIVKVMYA
Uniprot No.

Target Background

Function

Important Function: CrcB homolog plays a crucial role in reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the CrcB homolog protein compare structurally and functionally between different Campylobacter species?

Structural and functional comparisons of CrcB homologs across Campylobacter species reveal evolutionary conservation of this protein family. The CrcB homolog in C. fetus subsp. fetus (strain 82-40) shows significant sequence similarity to homologous proteins in other Campylobacter species and related genera .

Comparative genomic analyses indicate that CrcB homologs are widely distributed among bacterial species, including within the Campylobacter genus. A phylogenetic analysis of related proteins places the C. fetus CrcB homolog in the same cluster as those from Sodalis glossinidius morsitans and Leptospira species, suggesting potential horizontal gene transfer or convergent evolution .

The high conservation of this protein across different bacterial species highlights its essential role in bacterial physiology, particularly in environments where fluoride exposure might occur. Unlike some subspecies-specific virulence factors identified in C. fetus comparative genomics studies, the CrcB homolog appears to be a core gene present in both C. fetus subspecies (fetus and venerealis) .

What expression systems are most effective for producing recombinant C. fetus CrcB homolog protein?

Multiple expression systems have been successfully employed for the production of recombinant C. fetus CrcB homolog protein, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay require optimization of codon usage, potential for inclusion body formation
YeastPost-translational modifications, proper folding of membrane proteinsLonger expression time, more complex media requirements
BaculovirusAdvanced folding machinery, suitable for complex proteinsMore technically demanding, higher cost
Mammalian cellMost sophisticated post-translational modificationsHighest cost, lowest yield, technically complex

For C. fetus CrcB homolog, in vitro E. coli expression systems have been successfully used to produce full-length protein with N-terminal 10xHis tags . The protein can be expressed from amino acids 1-128, covering the complete sequence. For membrane proteins like CrcB homolog, E. coli expression may require optimization to ensure proper folding and membrane insertion.

When expressing membrane proteins like CrcB, it's essential to consider the addition of appropriate detergents during purification to maintain protein solubility and structural integrity after extraction from membranes .

What are the optimal storage conditions and stability considerations for purified recombinant CrcB homolog protein?

For optimal stability and activity preservation of recombinant C. fetus CrcB homolog protein, the following storage conditions are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C in appropriate buffer systems.

  • Long-term storage:

    • For liquid preparations: Store at -20°C/-80°C, preferably in the presence of 50% glycerol to prevent freezing damage.

    • For lyophilized preparations: Store at -20°C/-80°C in sealed containers to prevent moisture absorption.

  • Buffer composition: Tris/PBS-based buffer systems with pH 8.0 containing 6% trehalose have been found effective for lyophilized preparations .

  • Avoiding degradation: Repeated freeze-thaw cycles significantly reduce protein stability and should be minimized by preparing single-use aliquots.

  • Shelf life considerations: Liquid preparations typically maintain stability for approximately 6 months at -20°C/-80°C, while properly lyophilized preparations can remain stable for 12 months under the same conditions .

It's important to note that CrcB, as a membrane protein, may require the presence of detergents or stabilizing agents to maintain its native conformation during storage, especially after purification.

How can the recombinant C. fetus CrcB homolog be used to study bacterial fluoride resistance mechanisms?

To investigate bacterial fluoride resistance mechanisms using recombinant C. fetus CrcB homolog protein, researchers can employ several experimental approaches:

  • Fluoride ion transport assays:

    • Reconstitute purified CrcB into liposomes loaded with a pH-sensitive fluorescent dye

    • Monitor changes in intravesicular pH upon addition of fluoride ions

    • Quantify transport rates under various conditions (pH, temperature, ion concentration)

  • Complementation studies in CrcB-deficient bacterial strains:

    • Generate CrcB knockout mutants in C. fetus or heterologous bacterial hosts

    • Express recombinant CrcB using plasmid vectors similar to those developed for C. fetus genetic manipulation

    • Assess restoration of fluoride resistance by measuring growth in media containing varying fluoride concentrations

  • Protein-protein interaction studies:

    • Use the recombinant protein with appropriate tags (such as the His-tag variant) for pull-down assays

    • Identify interaction partners that may participate in fluoride sensing or response pathways

    • Verify interactions using techniques like bacterial two-hybrid systems

  • Structural studies:

    • Perform crystallization trials with purified protein

    • Use structural data to identify critical residues for fluoride binding and transport

    • Conduct site-directed mutagenesis to validate the functional importance of these residues

This research is particularly relevant in understanding bacterial adaptation to environmental stresses and may have implications for antimicrobial resistance mechanisms, as fluoride is widely used in antibacterial applications.

What methodologies are recommended for analyzing interactions between CrcB homolog and other bacterial membrane components?

To effectively analyze interactions between CrcB homolog and other bacterial membrane components, researchers should consider these methodological approaches:

  • Membrane protein co-purification:

    • Perform tandem affinity purification using tagged CrcB homolog

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions using reversed co-immunoprecipitation

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Treat intact bacterial cells or purified membranes with membrane-permeable cross-linking agents

    • Purify CrcB under denaturing conditions to maintain cross-linked complexes

    • Identify cross-linked peptides by mass spectrometry to map protein-protein interfaces

  • Fluorescence resonance energy transfer (FRET) analysis:

    • Generate fusion proteins of CrcB and potential interaction partners with appropriate fluorophores

    • Express these constructs in C. fetus using the shuttle vector systems described in the literature

    • Measure FRET efficiency to quantify molecular proximity in living cells

  • Bacterial two-hybrid assays:

    • Adapt established bacterial two-hybrid systems for membrane protein analysis

    • Generate fusion constructs between CrcB fragments and reporter protein domains

    • Screen for interactions based on reporter gene activation

  • Lipid interaction studies:

    • Use techniques like lipid overlay assays or liposome binding assays

    • Determine if specific lipid species enhance CrcB function or stability

    • Correlate findings with C. fetus membrane composition analysis

These methodologies can provide insights into how CrcB functions within the complex membrane environment of C. fetus and potentially reveal new aspects of fluoride resistance mechanisms or other unexpected functions of this protein.

How does the CrcB homolog protein contribute to Campylobacter fetus survival in different host environments?

The contribution of CrcB homolog protein to C. fetus survival across diverse host environments involves multiple adaptive mechanisms:

What is the relationship between CrcB homolog expression and antibiotic resistance mechanisms in Campylobacter species?

The relationship between CrcB homolog expression and antibiotic resistance in Campylobacter species involves several direct and indirect mechanisms:

  • Membrane permeability modification:

    • As a transmembrane protein, CrcB contributes to membrane composition and potentially alters permeability

    • Changes in membrane permeability can affect the uptake of certain antibiotics, particularly hydrophilic compounds

  • Potential interaction with efflux systems:

    • Genomic analysis of C. fetus has identified various membrane transporters and efflux systems

    • CrcB may interact with or indirectly influence the function of these systems, affecting antibiotic export

  • Cross-resistance phenomena:

    • Fluoride resistance mechanisms mediated by CrcB may overlap with resistance pathways for certain antibiotics

    • Upregulation of CrcB in response to fluoride exposure might coincidentally enhance resistance to some antimicrobial agents

  • Genetic linkage considerations:

    • In some bacterial species, fluoride resistance genes are genetically linked to antibiotic resistance determinants

    • Analysis of the genomic context of CrcB in C. fetus could reveal potential operonic arrangements with resistance genes

  • Biofilm formation influence:

    • Membrane proteins can affect bacterial surface properties and influence biofilm formation

    • Biofilms significantly enhance antibiotic resistance through multiple mechanisms

Experimental approaches to investigate these relationships could include:

Experimental ApproachApplication for CrcB-Antibiotic Resistance Studies
Gene knockout/overexpressionGenerate CrcB mutants and evaluate changes in MICs for various antibiotics
Transcriptomic analysisAnalyze CrcB expression in response to antibiotic exposure
Membrane permeability assaysCompare uptake of fluorescent antibiotics in wild-type vs. CrcB-modified strains
Efflux inhibitor studiesDetermine if CrcB influences the effectiveness of efflux pump inhibitors
Biofilm formation assaysAssess the impact of CrcB modification on biofilm development and antibiotic resistance

While direct evidence linking CrcB to antibiotic resistance in Campylobacter is limited in the current literature, investigating these potential relationships could reveal important insights into bacterial adaptation mechanisms.

How has the CrcB homolog gene evolved across Campylobacter species and what does this reveal about selective pressures?

Evolutionary analysis of the CrcB homolog gene across Campylobacter species provides insights into selective pressures and adaptation mechanisms:

  • Sequence conservation patterns:

    • Core regions of the CrcB protein show high conservation, suggesting functional constraints

    • Membrane-spanning domains typically show greater conservation than loop regions

    • Residues involved in fluoride binding and transport are likely under strongest purifying selection

  • Phylogenetic distribution:

    • CrcB homologs are present across diverse Campylobacter species, indicating ancient evolutionary origins

    • The gene is found in both mammalian-associated (C. fetus subsp. fetus and C. fetus subsp. venerealis) and reptile-associated (C. fetus subsp. testudinum) lineages

  • Evidence of horizontal gene transfer:

    • Comparative genomic analyses place C. fetus CrcB in phylogenetic clusters with homologs from diverse bacterial species

    • This suggests potential horizontal gene transfer events contributing to its distribution

    • Unlike subspecies-specific genomic islands identified in C. fetus venerealis , CrcB appears to be part of the core genome

  • Host adaptation considerations:

    • Despite distinct host preferences between C. fetus subspecies, CrcB is maintained across lineages

    • This suggests its function is important regardless of specific host environment

    • Comparative analysis with the reptile-associated C. fetus subsp. testudinum could reveal host-specific adaptations

  • Comparison with recombination patterns:

    • Studies have demonstrated homologous recombination between genetically divergent C. fetus lineages

    • Analysis of whether CrcB regions participate in such recombination events could provide insights into selective pressures

This evolutionary analysis supports the hypothesis that CrcB serves a fundamental physiological role in Campylobacter species, likely related to fluoride detoxification, which remains important across diverse ecological niches and host environments.

How can recombinant CrcB homolog be utilized in the development of novel antimicrobial strategies targeting Campylobacter infections?

Recombinant CrcB homolog offers several avenues for developing novel antimicrobial strategies against Campylobacter infections:

  • Drug target validation:

    • Use purified recombinant CrcB for high-throughput screening of inhibitor compounds

    • Develop assays measuring fluoride transport inhibition as a primary screen

    • Validate hits with secondary assays in bacterial growth models

  • Structure-based drug design:

    • Generate high-resolution structural data of CrcB using X-ray crystallography or cryo-EM

    • Identify potential binding pockets for small molecule inhibitors

    • Design rational inhibitors targeting critical functional regions

  • Peptide inhibitor development:

    • Identify peptide sequences that interfere with CrcB oligomerization or function

    • Screen peptide libraries against recombinant CrcB

    • Optimize lead peptides for enhanced stability and cellular uptake

  • Immunotherapeutic approaches:

    • Use recombinant CrcB to generate antibodies targeting extracellular loops

    • Assess antibody-mediated inhibition of CrcB function

    • Evaluate potential for passive immunization strategies

  • Fluoride-based antimicrobial enhancement:

    • Investigate if CrcB inhibition sensitizes Campylobacter to fluoride

    • Develop combination strategies using CrcB inhibitors with fluoride-containing antimicrobials

    • Test effectiveness in relevant infection models

  • Delivery system development:

    • Design nanoparticles containing CrcB inhibitors and targeting Campylobacter surface structures

    • Use recombinant CrcB to test binding and targeting efficiency

    • Optimize formulations for in vivo delivery

This research direction is supported by the growing understanding of C. fetus molecular biology and the development of genetic tools for Campylobacter species . Furthermore, the conservation of CrcB across Campylobacter species suggests that effective inhibitors might have broad-spectrum activity against multiple pathogenic Campylobacter strains.

What are the challenges and methodological considerations in studying conformational changes of CrcB homolog during fluoride transport?

Studying conformational changes of CrcB homolog during fluoride transport presents several technical challenges that require sophisticated methodological approaches:

  • Membrane protein crystallization barriers:

    • CrcB, as a transmembrane protein, presents inherent crystallization difficulties

    • Solutions include:

      • Utilizing lipidic cubic phase crystallization methods

      • Engineering fusion proteins with crystallization chaperones

      • Employing nanobodies to stabilize specific conformational states

  • Capturing transport-relevant conformations:

    • Ion channels typically cycle through multiple conformational states

    • Strategies include:

      • Using fluoride analogs that trap specific conformational intermediates

      • Engineering mutations that favor particular conformational states

      • Employing time-resolved structural techniques

  • Biophysical technique limitations:

    • Membrane protein dynamics are challenging to study in native-like environments

    • Advanced approaches include:

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

      • Single-molecule FRET to track distance changes between labeled residues

      • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Computational modeling challenges:

    • Simulation of membrane environments and ion transport is computationally intensive

    • Solutions include:

      • Enhanced sampling molecular dynamics simulations

      • Mixed quantum mechanics/molecular mechanics approaches for ion interactions

      • Coarse-grained models for longer timescale conformational changes

  • Native lipid environment reconstitution:

    • Protein function may depend on specific lipid interactions

    • Approaches include:

      • Native nanodiscs incorporating bacterial membrane lipids

      • Lipid composition screening to identify optimal functional conditions

      • Lipidomic analysis of C. fetus membranes to guide reconstitution

  • Functional assay development:

    • Correlating structural changes with transport activity is essential

    • Methodologies include:

      • Development of fluorescent indicators for fluoride transport

      • Patch-clamp electrophysiology of reconstituted CrcB

      • Stopped-flow spectroscopy to measure transport kinetics

These methodological considerations highlight the complex, multidisciplinary approach required to understand CrcB conformational dynamics during fluoride transport. The development of such techniques would not only advance our understanding of CrcB function but could also be applied to other transporters in Campylobacter species, potentially revealing new drug targets.

How can CrcB homolog research be integrated with broader studies on Campylobacter fetus pathogenicity and host adaptation?

Integrating CrcB homolog research with broader studies on C. fetus pathogenicity and host adaptation requires a multidisciplinary approach:

  • Transcriptomic profiling during host colonization:

    • Analyze CrcB expression patterns during infection of different host tissues

    • Compare expression between C. fetus subsp. fetus (generalist) and C. fetus subsp. venerealis (reproductive tract specialist)

    • Correlate CrcB expression with other virulence factors in different host microenvironments

  • Interactome mapping with known virulence factors:

    • Investigate potential interactions between CrcB and established virulence proteins

    • Focus on connections with Type IV secretion systems, which are key virulence determinants in C. fetus subsp. venerealis

    • Explore possible relationships with surface layer proteins (SLPs) that mediate immune evasion

  • Host response studies:

    • Examine if CrcB affects host cell responses during infection

    • Investigate if CrcB mutants elicit different inflammatory responses

    • Determine if CrcB is recognized by host immune receptors

  • Comparative genomic integration:

    • Analyze CrcB genetic context across C. fetus isolates from different hosts

    • Investigate if CrcB sequences show host-specific adaptations

    • Assess if CrcB regions participate in the homologous recombination events documented between C. fetus subspecies

  • Multi-omics functional networks:

    • Integrate CrcB research into systems biology analyses of C. fetus

    • Create functional networks connecting CrcB with other cellular processes

    • Identify condition-specific regulatory hubs affecting CrcB function

  • Animal model validation:

    • Test CrcB mutants in relevant animal models of C. fetus infection

    • Evaluate tissue-specific colonization patterns

    • Assess competitive fitness between wild-type and CrcB-modified strains

This integrative approach would position CrcB research within the broader context of C. fetus biology, potentially revealing unexpected connections between basic physiological functions and pathogenicity mechanisms. The availability of genetic tools for C. fetus facilitates these integrated studies by enabling targeted genetic manipulations.

What collaborative research frameworks would be most effective for comprehensive characterization of CrcB and related membrane proteins in Campylobacter species?

Effective collaborative research frameworks for comprehensive characterization of CrcB and related membrane proteins in Campylobacter species should incorporate multiple disciplines and technologies:

  • Cross-institutional consortium structure:

    • Core facilities specializing in:

      • Protein production and structural biology

      • Functional characterization and transport assays

      • Microbial genetics and molecular biology

      • Infection models and host-pathogen interactions

      • Computational biology and systems modeling

  • Technology integration platforms:

    • Centralized data repositories for:

      • Structural data from multiple techniques (X-ray, cryo-EM, NMR)

      • Functional assay results in standardized formats

      • Genomic and transcriptomic datasets

      • Phenotypic screenings of mutant libraries

    • Standardized protocols for cross-validation between laboratories

  • Multi-species comparative framework:

    • Parallel investigation of CrcB homologs across:

      • Multiple Campylobacter species (C. fetus, C. jejuni, C. coli)

      • Related ε-proteobacteria

      • Diverse bacterial phyla for evolutionary insights

    • Standardized phenotypic characterization protocols

  • Translational research components:

    • Integration with antimicrobial discovery pipelines

    • Collaboration with clinicians studying Campylobacter infections

    • Partnerships with agricultural researchers focusing on livestock infections

  • Methodological workflow integration:

    Research PhaseContributing DisciplinesKey Technologies
    Protein characterizationBiochemistry, Structural biologyRecombinant expression, Crystallography, cryo-EM
    Functional analysisBiophysics, ElectrophysiologyLiposome reconstitution, Patch-clamp, Fluorescence assays
    Genetic studiesMolecular biology, Microbial geneticsCRISPR-Cas9 editing, Shuttle vectors, Transposon mutagenesis
    Host interactionImmunology, Cell biologyCell culture models, Animal infection models
    Systems integrationComputational biology, BioinformaticsNetwork analysis, Multi-omics integration, Machine learning
  • Training and knowledge dissemination components:

    • Workshops on specialized techniques

    • Development of standardized research protocols

    • Creation of shared reagent repositories

    • Open-access publication strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.