Recombinant Campylobacter fetus subsp. fetus Putative protein-disulfide oxidoreductase (CFF8240_0434)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

CFF8240_0434 is hypothesized to contribute to C. fetus virulence through two primary mechanisms:

A. Oxidative Protein Folding
As a putative protein-disulfide oxidoreductase, CFF8240_0434 likely catalyzes disulfide bond formation in periplasmic proteins, including surface array proteins (SAPs). SAPs form the S-layer, a critical virulence factor that shields C. fetus from complement-mediated immune responses .

B. Isomerase Activity
Structural homology with E. coli DsbC and Pyrococcus furiosus PDO suggests CFF8240_0434 may correct misformed disulfide bonds in substrate proteins, similar to ScsC in Citrobacter and Salmonella . This activity ensures proper folding of adhesion molecules or toxins involved in host-pathogen interactions .

Recombinant Expression and Purification

The protein is expressed in E. coli (strain unspecified) and purified via affinity chromatography leveraging the His-tag . Key production details:

  • Expression System: E. coli (optimized for redox-active protein expression).

  • Yield: Not explicitly quantified but typical for recombinant His-tagged proteins (~1–5 mg/L culture).

  • Quality Control: Confirmed by mass spectrometry and N-terminal sequencing .

Pathogenicity Studies

CFF8240_0434 is used to investigate the role of disulfide bond formation in C. fetus virulence. For example:

  • The S-layer’s SAPs require disulfide bonds for lattice stability, which enables immune evasion .

  • Mutational studies on CXXC motifs could clarify its redox specificity (oxidase vs. isomerase) .

Comparative Enzymology

Studies on homologs like Pyrococcus furiosus PDO reveal that dual CXXC motifs enable multifunctional redox activity (oxidation, reduction, isomerization) . CFF8240_0434’s catalytic residues (Cys35 and Cys146) likely operate similarly, with the CPYC motif in the C-terminal domain being critical for isomerase activity .

Diagnostic and Therapeutic Development

  • Antigen Production: Recombinant CFF8240_0434 serves as an antigen for antibody generation to detect C. fetus infections .

  • Drug Target: Inhibitors targeting disulfide oxidoreductases could disrupt C. fetus virulence, as seen in studies on vitamin D analogs and PDI .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbI; CFF8240_0434; Putative protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Campylobacter fetus subsp. fetus (strain 82-40)
Target Names
dsbI
Target Protein Sequence
MEFFKDLKSDPIGKVASLQDERAIWIIMVVAMSGLVIVAHSLFQNYVYMAPCEQCVYIRF SMLVMALGGVIAAINPKNIILKIIGYVLGFYGAIIGMMYCIKLNSIHHAVHSEDPFGVQG CSAEPSFPFGLPLDMWAPDWFKPTGDCGYDNPIVPDDVSLSWLQQWFVDFYSEGWYLIPS LKFMNMAQACFIAYAVAFILLFAMFICWILKLKRA
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in certain proteins. It is part of a redox system composed of DsbI and DsbL that facilitates the formation of an essential disulfide bond in AssT.
Database Links
Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of protein-disulfide oxidoreductase in Campylobacter fetus subsp. fetus?

Protein-disulfide oxidoreductase (CFF8240_0434, also known as DsbI) is involved in the formation and rearrangement of disulfide bonds in proteins. In Campylobacter species, this enzyme likely plays a critical role in protein folding and stability, which is essential for bacterial virulence and survival. The protein belongs to the disulfide bond (Dsb) family of enzymes that catalyze the oxidation of cysteine residues to form disulfide bonds during protein folding in the bacterial periplasm . In C. fetus subsp. fetus, this oxidoreductase may be particularly important for the proper folding of virulence factors and surface proteins that enable the pathogen to colonize and cause disease in its hosts .

How does C. fetus subsp. fetus differ from other Campylobacter species?

Campylobacter fetus comprises two subspecies, C. fetus subsp. fetus and C. fetus subsp. venerealis, which despite modest genomic differences show distinct host preferences and pathogenic mechanisms .

C. fetus subsp. fetus:

  • Can colonize and cause disease in multiple hosts including humans, sheep, and cattle

  • Transmitted to humans primarily through contaminated food

  • Can cause systemic infections and severe clinical manifestations, especially in immunocompromised individuals

  • Often associated with abortion in sheep (ovine campylobacteriosis)

In contrast, C. fetus subsp. venerealis:

  • Primarily a bovine pathogen with restricted host range

  • Sexually transmitted in cattle

  • Causes bovine venereal campylobacteriosis leading to abortion and infertility

  • Rarely associated with human infections

Both subspecies differ from Campylobacter jejuni, which is the leading cause of human bacterial gastroenteritis worldwide but uses different metabolic and respiratory pathways .

What role does the CXXC motif play in the catalytic mechanism of CFF8240_0434?

The CXXC motif (where X represents any amino acid) in CFF8240_0434 is critical for its oxidoreductase function. This conserved sequence typically contains two cysteine residues that cycle between oxidized (disulfide) and reduced (thiol) states during catalysis. The catalytic mechanism likely involves:

  • The N-terminal cysteine residue of the CXXC motif initiates a nucleophilic attack on the substrate protein's reduced cysteine residues

  • A mixed disulfide intermediate forms between the enzyme and substrate

  • The C-terminal cysteine of the CXXC motif then resolves this intermediate

  • This reaction results in the formation of a disulfide bond in the substrate protein and the reduction of the enzyme's CXXC motif

This mechanism is comparable to that observed in protein disulfide isomerase (PDI), where the rate-determining step in the oxidative regeneration path couples chemical thiol-disulfide-exchange reactions to physical conformational folding reactions . The spatial arrangement and pKa values of the cysteine residues significantly influence the redox potential and catalytic efficiency of the enzyme.

How does the membrane localization of CFF8240_0434 affect its function in protein folding pathways?

The membrane localization of CFF8240_0434, as suggested by its amino acid sequence, is integral to its biological function for several reasons:

  • Compartmentalization: By being membrane-associated, the oxidoreductase can operate in the periplasmic space where many secreted and membrane proteins fold and mature.

  • Coordination with protein translocation: The enzyme's membrane association enables it to interact with nascent polypeptides as they emerge from the Sec translocon, potentially mimicking the coordination between protein translocation, folding, and modification observed in native hosts like C. jejuni .

  • Redox environment regulation: Membrane-associated oxidoreductases help maintain the appropriate redox environment in the periplasm, which is crucial for disulfide bond formation.

  • Integration with electron transport chains: The positioning may allow the oxidoreductase to connect with electron transport components, facilitating the recycling of its redox state after catalysis, similar to how complex I components function in C. jejuni .

Research suggests that strategies to enhance recombinant protein production in heterologous hosts could benefit from understanding this spatial organization, as demonstrated by studies showing improved glycosylation efficiency when coordinating protein translocation, folding, and modification processes .

What experimental approaches can be used to determine if CFF8240_0434 interacts with specific substrates in C. fetus subsp. fetus?

To identify specific protein substrates of CFF8240_0434, researchers can employ several complementary experimental approaches:

ApproachMethodologyAdvantagesLimitations
Pull-down assaysUsing His-tagged recombinant CFF8240_0434 to capture interacting proteins from C. fetus lysatesAllows direct identification of physical interactionsMay miss transient interactions
Substrate trappingEngineering CFF8240_0434 with mutations in the resolving cysteine to stabilize enzyme-substrate complexesCaptures otherwise transient interactionsMay alter native specificity
Comparative proteomicsCompare disulfide bond profiles in wild-type vs. dsbI knockout strainsProvides physiological relevanceLabor-intensive and technically challenging
Bacterial two-hybrid assaysScreen for protein-protein interactions in vivoCan detect interactions in a cellular contextMay generate false positives
Differential cysteine labelingCompare accessibility of cysteine residues in various proteins between wild-type and dsbI mutantsDirectly assesses disulfide bond formationRequires specialized mass spectrometry

When designing these experiments, researchers should consider potential functional redundancy among oxidoreductases in C. fetus, as observed in studies of other bacterial systems. Additionally, the essential nature of dsbI in some contexts may necessitate conditional knockout strategies or depletion approaches rather than complete gene deletion .

What are the optimal conditions for expressing and purifying recombinant CFF8240_0434?

Expression and purification of recombinant CFF8240_0434 requires careful optimization to maintain protein structure and activity:

Expression system recommendations:

  • Host selection: E. coli BL21(DE3) or derivatives are commonly used for expressing recombinant Campylobacter proteins due to their reduced protease activity .

  • Temperature optimization: Lower induction temperatures (16-20°C) often improve folding of membrane-associated proteins.

  • Induction parameters: IPTG concentration of 0.1-0.5 mM with extended induction times (16-20 hours) at lower temperatures.

  • Media selection: Enriched media (such as Terrific Broth) supplemented with glucose can improve membrane protein expression.

Purification protocol:

  • Cell lysis: Gentle disruption using lysozyme treatment followed by sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol.

  • Membrane fraction isolation: Differential centrifugation to separate membrane fractions.

  • Solubilization: Use mild detergents such as n-dodecyl β-D-maltoside (DDM) or Triton X-100 to solubilize membrane proteins.

  • Affinity chromatography: Nickel-NTA affinity purification for His-tagged protein using imidazole gradient elution (50-250 mM) .

  • Storage: Maintain in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with 5-50% glycerol for long-term storage at -20°C/-80°C .

Researchers should avoid repeated freeze-thaw cycles and consider aliquoting purified protein for single use to maintain activity .

How can researchers assess the oxidoreductase activity of CFF8240_0434 in vitro?

Several complementary assays can be employed to characterize the oxidoreductase activity of CFF8240_0434:

  • Insulin reduction assay: This spectrophotometric assay measures the ability of the oxidoreductase to catalyze the reduction of insulin disulfide bonds, resulting in precipitation that can be monitored at 650 nm.

  • DiEosin Glutathione Disulfide (Di-E-GSSG) fluorescence assay: This sensitive fluorescence-based assay uses a quenched substrate that becomes fluorescent upon reduction, allowing real-time kinetic measurements.

  • Refolding of denatured RNase A: Similar to studies with PDI , researchers can monitor the ability of CFF8240_0434 to catalyze the refolding of denatured, reduced RNase A by measuring the recovery of enzymatic activity.

  • Redox potential determination: Equilibrium with glutathione redox buffers of varying ratios of reduced to oxidized glutathione can be used to determine the redox potential of the CXXC active site.

  • Thiol-disulfide exchange rate measurements: Stopped-flow kinetic measurements with model substrates can determine the rates of individual steps in the catalytic cycle.

When interpreting results, it's important to consider that the highly evolved oxidoreductase activity might mask chaperone-like activity, as observed with PDI, which can impede conformational folding of some proteins and limit the rate-determining step in oxidative regeneration .

What genetic approaches can be used to study the physiological role of CFF8240_0434 in C. fetus subsp. fetus?

The physiological importance of CFF8240_0434 can be investigated using several genetic approaches, with considerations for potential essentiality of the gene:

When designing genetic studies, researchers should consider the possibility that CFF8240_0434 may be an essential gene that cannot be disrupted unless an intact copy is provided elsewhere in the genome. This would require more sophisticated genetic approaches, such as conditional expression systems or partial gene deletions .

How does CFF8240_0434 contribute to the pathogenesis of C. fetus subsp. fetus infections?

CFF8240_0434, as a putative protein-disulfide oxidoreductase, likely plays a significant role in C. fetus subsp. fetus pathogenesis through several mechanisms:

  • Virulence factor maturation: Many bacterial virulence factors require proper disulfide bond formation for stability and function. CFF8240_0434 may be essential for the maturation of secreted toxins, adhesins, and invasins that enable host colonization and tissue damage.

  • Stress resistance: Proper protein folding mediated by oxidoreductases contributes to bacterial stress resistance, including survival during host immune responses and exposure to environmental stresses during transmission.

  • Surface protein display: C. fetus is known to produce surface layer proteins (SLPs) that contribute to immune evasion and host cell adherence. Correct folding of these proteins likely depends on oxidoreductase activity.

  • Metabolic adaptation: C. fetus subsp. fetus utilizes specific metabolic pathways for survival in different hosts. For instance, it can use small organic acids as carbon and energy sources, and the enzymes involved in these pathways may require disulfide bond formation for proper function .

The pathogen causes significant health issues in multiple hosts, including abortion in sheep (ovine campylobacteriosis) and systemic infections in humans, particularly in immunocompromised individuals . Understanding CFF8240_0434's role could provide insights into these diverse pathological manifestations.

How can understanding CFF8240_0434 inform the development of novel antimicrobial strategies?

The essential nature of proper protein folding for bacterial survival makes oxidoreductases attractive targets for antimicrobial development. Research on CFF8240_0434 could inform novel therapeutic strategies through:

The potential essentiality of dsbI, as suggested by studies in related systems where the gene could not be disrupted unless an intact copy was provided elsewhere , indicates that targeting this pathway could be particularly effective for antimicrobial development.

What is the potential for using CFF8240_0434 in biotechnological applications?

The oxidoreductase characteristics of CFF8240_0434 present several biotechnological opportunities:

  • Recombinant protein production enhancement: Knowledge about CFF8240_0434 could inform strategies to improve the production of correctly folded recombinant proteins with disulfide bonds in bacterial expression systems.

  • Glycoprotein engineering: Studies on Campylobacter-derived systems have shown that modulating protein folding in the periplasm through manipulating oxidoreductase activity can enhance glycosylation efficiency by up to 90% .

  • Enzyme evolution platforms: The substrate specificity and catalytic efficiency of CFF8240_0434 could be engineered for industrial biocatalysis applications requiring specific disulfide bond formation.

  • Biosensor development: The redox-sensing capabilities of oxidoreductases can be harnessed to develop biosensors for monitoring redox conditions in various environments.

  • Structural biology tools: Understanding how CFF8240_0434 facilitates protein folding could inform the development of new tools for structural biology, particularly for challenging membrane proteins.

Research has demonstrated that genetic and process engineering strategies, such as modulating protein folding in the periplasm through oxidoreductase activity, can significantly improve recombinant protein production in heterologous hosts like E. coli . This suggests that insights from CFF8240_0434 could have broad applications in biotechnology.

What are the main technical challenges in studying CFF8240_0434?

Researchers face several significant challenges when investigating CFF8240_0434:

  • Membrane protein expression and purification: As a membrane-associated protein, CFF8240_0434 presents inherent difficulties in expression, solubilization, and purification while maintaining native structure and function.

  • Essentiality limitations: If dsbI is indeed an essential gene, as suggested by related research , conventional knockout approaches for functional studies would be ineffective, requiring more sophisticated genetic tools.

  • Functional redundancy: Multiple oxidoreductases with overlapping functions may exist in C. fetus, complicating the attribution of specific phenotypes to CFF8240_0434.

  • Substrate identification complexity: The potentially transient nature of enzyme-substrate interactions makes identifying physiological substrates technically challenging.

  • Host-specific factors: Studying the protein in heterologous hosts may not fully recapitulate its native function due to differences in the periplasmic environment, redox partners, or substrate availability.

  • Limited genetic tools for C. fetus: Compared to model organisms, genetic manipulation of C. fetus subspecies remains challenging, limiting the approaches available for in vivo studies.

Researchers should consider these challenges when designing experiments and interpreting results, particularly when extrapolating from heterologous expression systems to the native context in C. fetus subsp. fetus .

What innovative approaches could advance our understanding of CFF8240_0434 function?

Several cutting-edge approaches could overcome current limitations and provide deeper insights into CFF8240_0434 function:

  • CRISPR interference (CRISPRi): This approach could allow titratable repression of dsbI expression without complete gene deletion, enabling study of an essential gene's function.

  • In situ structural analysis: Techniques such as cryo-electron tomography could visualize CFF8240_0434 in its native membrane environment, providing insights into its spatial organization and interactions.

  • Redox proteomics: Mass spectrometry-based approaches to map the disulfide proteome of C. fetus under various conditions could identify physiological substrates of CFF8240_0434.

  • Single-molecule FRET studies: These could elucidate the conformational dynamics during catalysis and interaction with substrates.

  • Synthetic biology approaches: Reconstituting minimal systems for disulfide bond formation in liposomes or cell-free systems could isolate the specific functions of CFF8240_0434.

  • Comparative genomics and systems biology: Integrating data across multiple Campylobacter species could reveal evolutionary patterns and functional networks involving CFF8240_0434.

Mimicking the coordination between protein translocation, folding, and modification observed in native hosts like C. jejuni could improve heterologous expression systems and provide insights into the natural function of CFF8240_0434 .

How might climate change and evolving agricultural practices influence C. fetus subsp. fetus prevalence and the importance of studying proteins like CFF8240_0434?

The dynamic interplay between environmental changes and pathogen adaptation highlights the continued importance of studying virulence-associated proteins like CFF8240_0434:

  • Changing transmission patterns: As climate patterns shift, the geographic distribution and seasonal prevalence of C. fetus subsp. fetus may change, potentially exposing new populations to this pathogen.

  • Livestock management adaptations: Evolving agricultural practices in response to climate change may alter animal housing density, feeding practices, and stress levels, potentially affecting C. fetus transmission and virulence expression.

  • Cross-species transmission risks: Changes in wildlife-livestock-human interfaces due to habitat shifts could create new opportunities for C. fetus host adaptation, where proteins involved in stress response and virulence like CFF8240_0434 would play key roles.

  • Antimicrobial resistance pressures: Changing patterns of antimicrobial use in agriculture could drive selection for resistant C. fetus strains, potentially enhancing the value of alternative targets like oxidoreductases for therapeutic development.

  • Vaccine stability challenges: Climate-related temperature increases may affect the stability of vaccines and therapeutics targeting C. fetus, making fundamental understanding of protein structure and folding increasingly important.

Understanding the biochemical mechanisms of pathogen adaptation, including the role of CFF8240_0434 in protein folding and stress response, will be essential for developing sustainable strategies to manage C. fetus infections in both animal agriculture and human health contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.