Recombinant Campylobacter fetus subsp. fetus UPF0059 membrane protein CFF8240_1725 (CFF8240_1725)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CFF8240_1725 is a 181-amino-acid membrane protein encoded by the gene CFF8240_1725 in Campylobacter fetus subsp. fetus strain 82-40. Key attributes include:

PropertyDetails
UniProt IDA0RRL1
Molecular Weight~19.7 kDa (theoretical)
Expression SystemEscherichia coli with N-terminal His tag
FunctionPutative manganese efflux pump (MntP family)
Subcellular LocalizationInner membrane; multi-pass transmembrane protein

The recombinant protein is purified using affinity chromatography and is available in lyophilized or liquid formats, stabilized in Tris-based buffer with glycerol .

Gene and Domain Organization

  • The gene CFF8240_1725 is located on chromosome NC_008599.1 (positions 1,683,411–1,683,956, complement strand) .

  • The protein belongs to the MntP family (TC 9.B.29), which facilitates manganese transport to mitigate metal toxicity .

Sequence and Topology

  • The N-terminal sequence begins with MELIFLSIAL..., and computational predictions indicate 4–6 transmembrane helices .

  • Structural homology modeling suggests conserved residues critical for metal ion coordination and transport .

Biochemical Activity

  • Functional studies of orthologs indicate that MntP-family proteins extrude excess manganese to maintain cellular homeostasis, a process vital for bacterial survival under oxidative stress .

Vaccine Development

  • Recombinant CFF8240_1725 is used as an antigen in preclinical studies to evaluate immune responses against C. fetus, which causes spontaneous abortions in livestock and opportunistic infections in immunocompromised humans .

  • ELISA-based assays utilize this protein to detect C. fetus-specific antibodies in serum samples .

Biophysical Characterization

  • Mass photometry (as described in ) could assess its oligomerization state in detergent or nanodiscs, critical for functional studies.

  • FTIR spectroscopy (see ) might analyze lipid-protein interactions to understand its membrane integration mechanics.

Clinical and Agricultural Relevance

  • C. fetus infections in cattle and sheep lead to significant economic losses due to reproductive failures .

  • Targeting CFF8240_1725 could disrupt manganese homeostasis, offering a therapeutic strategy against pathogenic Campylobacter strains .

  • Expression Optimization: Improving yields in E. coli for structural studies (e.g., cryo-EM) remains a hurdle .

  • Functional Validation: Direct evidence of manganese transport activity for CFF8240_1725 is needed .

  • Therapeutic Exploration: Screening small-molecule inhibitors targeting its ion-binding pockets could advance antimicrobial development .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that specific tag.
Synonyms
mntP; CFF8240_1725; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Campylobacter fetus subsp. fetus (strain 82-40)
Target Names
mntP
Target Protein Sequence
MELIFLSIALAMDSVAISMANGARCMNIKALQIFKMSFLFGIFQAFMPVIGYFLGLAFVG FISYIDHYVAFAILLFLGIKMIKESRQISVHCSLNLSLRMLMLGAFATSLDALAVGITFS FEEINIAIAAFVIGLVCFVLCVIASYMGRVLGEMLESKALVLGGVILILIGCKIIITHLI N
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Campylobacter fetus subsp. fetus UPF0059 membrane protein CFF8240_1725?

The CFF8240_1725 protein is a 181 amino acid membrane protein from Campylobacter fetus subsp. fetus. Its amino acid sequence is: MELIFLSIALAMDSVAISMANGARCMNIKALQIFKMSFLFGIFQAFMPVIGYFLGLAFVGFISYIDHYVAFAILLFLGIKMIKESRQISVHCSLNLSLRMLMLGAFATSLDALAVGITFSFEEINIAIAAFVIGLVCFVLCVIASYMGRVLGEMLESKALVLGGVILILIGCKIIITHLIN . The protein is also known as MntP and functions as a putative manganese efflux pump . Its membrane localization suggests it plays a role in ion transport across the bacterial cell membrane, specifically in manganese homeostasis, which is critical for bacterial survival and pathogenesis.

What expression systems are recommended for producing recombinant CFF8240_1725 protein?

E. coli expression systems are most commonly used for producing recombinant CFF8240_1725 protein, as demonstrated in current research protocols . When designing your expression system, consider the following methodological approach:

  • Select an E. coli strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Use an expression vector containing an N-terminal His-tag for purification

  • Implement controlled induction conditions (temperature, IPTG concentration)

  • Establish optimal growth parameters to maximize protein yield while maintaining proper folding

While E. coli is the standard system, researchers investigating protein-protein interactions within Campylobacter species might consider homologous expression, though this presents technical challenges due to Campylobacter's growth requirements.

How should recombinant CFF8240_1725 protein be stored to maintain stability?

The recombinant protein should be stored as a lyophilized powder at -20°C/-80°C upon receipt . For working aliquots, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add glycerol to a final concentration of 50%, and store at -20°C/-80°C . For short-term use, aliquots can be stored at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and function .

For optimal stability, the reconstitution buffer should be Tris-based with a pH of 8.0 . Researchers should validate protein stability for their specific applications by performing activity assays before and after various storage conditions.

What are the key considerations when designing functional assays for CFF8240_1725?

When designing functional assays for CFF8240_1725, researchers should implement a systematic experimental design approach:

  • Define clear variables related to the putative manganese transport function:

    • Independent variable: Manganese concentration in different cellular compartments

    • Dependent variable: Transport activity or manganese efflux rates

    • Control variables: pH, temperature, membrane integrity

  • Develop testable hypotheses about protein function based on its characterization as a putative manganese efflux pump

  • Design experimental treatments that manipulate manganese concentrations while monitoring cellular responses

  • Establish appropriate control conditions, including:

    • Protein-free negative controls

    • Known manganese transporters as positive controls

    • Inactive protein mutants as specificity controls

  • Implement appropriate measurement techniques for manganese transport, such as:

    • Radioactive tracer assays

    • Fluorescent indicator assays

    • ICP-MS for precise quantification

Following these experimental design principles will enable rigorous assessment of CFF8240_1725 function and provide reliable data for interpretation .

What purification strategies yield highest purity and activity for recombinant CFF8240_1725?

Obtaining high-purity, active CFF8240_1725 requires a methodical purification approach:

  • Cell lysis optimization:

    • Use gentle disruption methods suitable for membrane proteins

    • Include protease inhibitors to prevent degradation

    • Maintain appropriate temperature conditions (4°C recommended)

  • Membrane fraction isolation:

    • Differential centrifugation to separate cellular components

    • Collect membrane fraction containing the target protein

  • Solubilization optimization:

    • Test multiple detergents (DDM, LDAO, OG) at various concentrations

    • Monitor protein stability in each detergent condition

    • Select conditions that maximize extraction while preserving function

  • Affinity chromatography:

    • Utilize the N-terminal His-tag for IMAC purification

    • Implement optimized imidazole gradient to reduce non-specific binding

    • Include detergent in all buffers at concentrations above CMC

  • Purity assessment:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blot verification of target protein

    • Size exclusion chromatography for final polishing

This systematic approach ensures both high purity and preserved activity of the membrane protein for subsequent functional analyses.

How can whole genome sequencing approaches be applied to study CFF8240_1725 genetic variation across Campylobacter fetus strains?

Whole genome sequencing (WGS) offers powerful insights into CFF8240_1725 genetic diversity through the following methodological framework:

  • Sample preparation:

    • Collect diverse C. fetus isolates from various sources (clinical, environmental)

    • Extract high-quality genomic DNA using specialized kits

    • Prepare libraries using Illumina Nextera DNA Library Preparation Kit

  • Sequencing methodology:

    • Implement paired-end next-generation sequencing (2×150 bp reads)

    • Achieve sufficient coverage (30-50×) for reliable variant calling

    • Include quality controls and standards

  • Bioinformatic analysis pipeline:

    • Perform quality assessment using FastQC v0.11.9

    • Clean and assemble reads using tools like Sickle v1.33 and SPAdes

    • Identify species using Average Nucleotide Identity (ANI) algorithm

  • CFF8240_1725 locus analysis:

    • Extract sequence data specifically for the CFF8240_1725 gene region

    • Perform multiple sequence alignment to identify variants

    • Calculate nucleotide diversity metrics

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on whole-genome SNP analysis

    • Examine evolutionary relationships between strains

    • Correlate genetic variation with phenotypic characteristics

This approach enables researchers to understand how CFF8240_1725 variants correlate with strain virulence, host specificity, or environmental adaptation.

What techniques can be employed to study protein-protein interactions involving CFF8240_1725?

Studying protein-protein interactions for CFF8240_1725 requires specialized approaches suitable for membrane proteins:

  • Co-immunoprecipitation studies:

    • Express tagged CFF8240_1725 in C. fetus or heterologous system

    • Solubilize membranes with carefully selected detergents

    • Perform pull-down assays with tag-specific antibodies

    • Identify interacting partners via mass spectrometry

  • Crosslinking approaches:

    • Apply membrane-permeable crosslinkers to intact cells

    • Isolate CFF8240_1725 complexes

    • Identify crosslinked partners through tandem mass spectrometry

    • Validate interactions with targeted approaches

  • Bacterial two-hybrid systems:

    • Adapt bacterial two-hybrid methodology for membrane protein analysis

    • Screen for interacting partners using reporter gene activation

    • Confirm interactions through independent methods

  • Fluorescence-based techniques:

    • Implement FRET or BiFC to visualize interactions in situ

    • Optimize fluorophore placement to minimize interference with protein function

    • Quantify interaction dynamics under various physiological conditions

These methodologies provide complementary insights into the protein interaction network of CFF8240_1725, revealing its functional role within the cellular context.

What structural features of CFF8240_1725 are critical for its putative manganese transport function?

Analysis of the CFF8240_1725 amino acid sequence reveals several structural features likely critical for its putative manganese transport function:

  • Transmembrane domains:

    • The protein contains multiple hydrophobic segments that likely form transmembrane helices

    • These helices create a channel or pore for ion passage across the membrane

    • The sequence MELIFLSIALAMDSVAISMANGARCMNIKAL contains the first predicted transmembrane segment

  • Ion binding sites:

    • Conserved acidic residues (D, E) likely participate in manganese coordination

    • Specific motifs may form selective binding pockets for manganese over other divalent cations

    • The sequence regions QISVHCSLNLSLRMLMLGAFATSLDAL may contain critical binding residues

  • Conformational change elements:

    • Regions that undergo structural rearrangements during transport cycle

    • Flexible linkers between rigid structural elements

    • The sequence FEEINIAIAA may participate in these conformational changes

  • Oligomerization interfaces:

    • Residues involved in protein-protein interactions for potential dimer/oligomer formation

    • These interfaces may be critical for creating functional transport units

Researchers should consider targeted mutagenesis of these key regions to establish structure-function relationships experimentally.

How can computational approaches complement experimental studies of CFF8240_1725 function?

Computational approaches offer valuable insights that complement experimental studies of CFF8240_1725 through the following methodological framework:

  • Homology modeling:

    • Identify structural homologs in protein databases

    • Build three-dimensional models based on related transporters

    • Refine models through energy minimization

    • Validate models using quality assessment tools

  • Molecular dynamics simulations:

    • Embed protein models in simulated lipid bilayers

    • Simulate protein behavior in membrane environment

    • Analyze conformational changes during transport cycles

    • Identify water and ion pathways through the protein

  • Docking and binding site prediction:

    • Predict manganese binding sites within the protein structure

    • Calculate binding energies for various metal ions

    • Identify residues critical for selective ion binding

  • Evolutionary analysis:

    • Perform multiple sequence alignment across bacterial species

    • Identify conserved residues indicating functional importance

    • Analyze co-evolution patterns suggesting interaction networks

    • Trace evolutionary relationships among manganese transporters

  • Integration with experimental data:

    • Incorporate experimental constraints into computational models

    • Develop testable hypotheses for experimental validation

    • Iteratively refine models based on new experimental findings

This integrated computational-experimental approach accelerates understanding of CFF8240_1725 structure-function relationships and guides rational experimental design.

What strategies can be employed for genetic manipulation of CFF8240_1725 in C. fetus?

Genetic manipulation of CFF8240_1725 in C. fetus requires specialized approaches due to the bacteria's transformation barriers:

  • Homologous recombination strategy:

    • Design targeting constructs with homology arms flanking CFF8240_1725

    • Include selectable markers (antibiotic resistance) for recombinant selection

    • Optimize DNA introduction methods (electroporation parameters)

    • Implement PCR verification with primers spanning insertion junctions

  • Natural transformation optimization:

    • Identify conditions that enhance natural competence

    • Prepare donor DNA with appropriate modifications

    • Monitor recombination efficiency with extended incubation times

    • Select transformants on appropriate selective media

  • CRISPR-Cas9 adaptation:

    • Design guide RNAs targeting CFF8240_1725

    • Optimize Cas9 expression in C. fetus

    • Provide repair templates for precise genetic modifications

    • Screen for successful gene editing events

  • Transposon mutagenesis:

    • Implement transposon delivery systems effective in C. fetus

    • Screen for insertions in CFF8240_1725

    • Characterize resulting phenotypic changes

    • Complement mutations to confirm specificity

  • Conditional expression systems:

    • Develop inducible promoters functional in C. fetus

    • Create constructs for controlled CFF8240_1725 expression

    • Monitor effects of altered expression levels

These methodologies provide researchers with tools to investigate CFF8240_1725 function through genetic manipulation directly in the native host organism.

How does CFF8240_1725 expression impact virulence in C. fetus infection models?

The relationship between CFF8240_1725 expression and C. fetus virulence can be systematically investigated using the following methodological approach:

  • Expression analysis in clinical isolates:

    • Compare CFF8240_1725 expression levels among strains with varying virulence

    • Implement RT-qPCR for transcript quantification

    • Perform western blot analysis for protein detection

    • Correlate expression patterns with virulence phenotypes

  • Creation of isogenic mutants:

    • Generate CFF8240_1725 deletion or overexpression strains

    • Verify genetic modifications through whole genome sequencing

    • Confirm altered expression patterns

    • Maintain isogenic backgrounds to isolate CFF8240_1725 effects

  • In vitro virulence assays:

    • Evaluate adhesion to epithelial cell lines

    • Measure invasion efficiency

    • Assess intracellular survival

    • Determine resistance to antimicrobial peptides

  • Infection models:

    • Select appropriate animal models reflecting C. fetus pathogenesis

    • Monitor colonization dynamics

    • Assess tissue damage and inflammatory responses

    • Measure bacterial dissemination to various organs

  • Virulence factor expression:

    • Analyze expression of known virulence genes in response to CFF8240_1725 modification

    • Identify virulence protein signatures through proteomics

    • Evaluate secreted virulence factors

Research has identified several virulence-associated proteins in C. fetus, including S-layer proteins, ABC transporters, adhesins, and flagellar proteins . Understanding how CFF8240_1725 interacts with these established virulence factors would provide valuable insights into pathogenesis mechanisms.

What are common challenges in purifying active CFF8240_1725 and how can they be addressed?

Purification of active CFF8240_1725 presents several technical challenges that can be systematically addressed:

  • Poor expression yields:

    • Challenge: Low protein production in expression systems

    • Solution: Optimize codon usage for expression host

    • Solution: Test different promoter strengths and induction conditions

    • Solution: Evaluate growth at lower temperatures (16-20°C) to improve folding

  • Inclusion body formation:

    • Challenge: Protein aggregation in insoluble fractions

    • Solution: Co-express molecular chaperones

    • Solution: Add chemical chaperones to growth media

    • Solution: Implement refolding protocols optimized for membrane proteins

  • Inefficient membrane extraction:

    • Challenge: Incomplete solubilization from membranes

    • Solution: Screen multiple detergents and concentrations

    • Solution: Optimize detergent:protein ratios

    • Solution: Consider alternative solubilization agents (SMALPs, nanodiscs)

  • Protein instability:

    • Challenge: Rapid degradation during purification

    • Solution: Work at 4°C throughout the procedure

    • Solution: Include protease inhibitor cocktails

    • Solution: Minimize purification duration through protocol optimization

  • Loss of activity:

    • Challenge: Purified protein lacks transport function

    • Solution: Verify proper folding through circular dichroism

    • Solution: Reconstitute into liposomes to restore native-like environment

    • Solution: Add stabilizing lipids throughout purification

Implementing these methodological solutions can significantly improve the yield and activity of purified CFF8240_1725 for subsequent functional studies.

How can researchers troubleshoot inconsistent results in CFF8240_1725 functional assays?

Addressing inconsistency in CFF8240_1725 functional assays requires systematic troubleshooting:

  • Assay standardization:

    • Implement rigorous controls for each experiment

    • Standardize protein quantification methods

    • Establish detailed protocols with defined parameters

    • Verify reagent quality and prepare fresh working solutions

  • Protein quality assessment:

    • Verify protein integrity by SDS-PAGE before each assay

    • Confirm proper folding through biophysical techniques

    • Assess oligomeric state through size exclusion chromatography

    • Validate activity using established functional assays

  • Environmental variable control:

    • Maintain consistent temperature during assays

    • Control pH precisely in all buffer systems

    • Standardize ion concentrations, particularly divalent cations

    • Minimize exposure to oxidizing conditions

  • Data analysis approaches:

    • Implement appropriate statistical methods

    • Identify and manage outliers systematically

    • Use multiple technical and biological replicates

    • Apply normalization strategies consistently

  • Instrument calibration:

    • Regularly calibrate all measurement equipment

    • Perform standard curves with each experiment

    • Include internal standards for quantitative assays

    • Validate detection methods with known controls

By implementing these troubleshooting strategies, researchers can improve reproducibility and reliability in CFF8240_1725 functional assessments.

How might CFF8240_1725 contribute to C. fetus pathogenesis in foodborne illness outbreaks?

Understanding CFF8240_1725's potential role in C. fetus pathogenesis requires integrating multiple research approaches:

  • Outbreak investigation correlation:

    • Analyze CFF8240_1725 sequence variations in outbreak isolates

    • Perform whole genome sequencing of clinical isolates

    • Compare genetic identity across outbreak clusters

    • Correlate genetic variations with clinical severity

  • Host-pathogen interaction studies:

    • Evaluate CFF8240_1725 expression during host cell contact

    • Assess contribution to epithelial cell adhesion and invasion

    • Determine role in resistance to host defense mechanisms

    • Investigate impact on bacterial survival in bloodstream

  • Manganese homeostasis in infection:

    • Measure intracellular manganese during infection process

    • Determine how host manganese limitation affects C. fetus virulence

    • Evaluate competition with host manganese-binding proteins

    • Assess virulence of CFF8240_1725 mutants in manganese-limited conditions

  • Contribution to clinical manifestations:

    • Investigate relationship to bacteremia development

    • Assess role in osteoarticular medical device infections

    • Determine involvement in persistent infections

    • Evaluate contribution to antibiotic resistance phenotypes

Recent outbreaks of C. fetus foodborne illness have demonstrated significant morbidity in elderly patients, including bacteremia and osteoarticular medical device infections . Research connecting CFF8240_1725 function to these severe clinical manifestations would provide valuable insights for prevention and treatment strategies.

What role might CFF8240_1725 play in environmental persistence of C. fetus?

The potential contribution of CFF8240_1725 to environmental persistence can be investigated through these methodological approaches:

  • Stress response studies:

    • Evaluate CFF8240_1725 expression under various environmental stressors

    • Monitor manganese transport activity during temperature fluctuations

    • Assess protein function during nutrient limitation

    • Determine role in resistance to oxidative and pH stress

  • Biofilm formation analysis:

    • Compare biofilm formation between wild-type and CFF8240_1725 mutants

    • Evaluate protein expression in biofilm versus planktonic states

    • Assess manganese requirements during biofilm development

    • Determine localization of CFF8240_1725 within biofilm architecture

  • Environmental survival assays:

    • Measure persistence in food-relevant matrices

    • Evaluate survival in unpasteurized dairy products

    • Monitor viability in water systems

    • Assess transmission potential through environmental routes

  • Interspecies competition:

    • Determine competitive advantage in mixed microbial communities

    • Assess manganese sequestration as a competitive strategy

    • Evaluate horizontal gene transfer of CFF8240_1725 variants

    • Measure fitness costs of CFF8240_1725 mutations

Understanding CFF8240_1725's role in environmental persistence would provide insights into C. fetus transmission dynamics and inform risk assessment strategies for food safety.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.