Recombinant Campylobacter hominis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; CHAB381_0723; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A)
Target Names
atpB
Target Protein Sequence
MLKDIFLFWGSLFGYDHTAIYIFHFLLVVAITMFIAVAVTKSMRLVPRGLQNIIEAYLSG VIALGKDAMGSEKLARKYMPLIATIGFIVFLSNIIGLIPGFEAPTASLNLTLSLTLCVFF YYHFEGIREKGFIKYFAGFCGPVKAIAPFMFVIEVISHLSRIISLSFRLFGNIKGDDLFL LVMLTLAPVLVPMIPYALLSFMAILQAFIFMVLSYVYLAGAVVVDEEH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Campylobacter hominis?

ATP synthase subunit a (atpB) in C. hominis is a critical membrane-embedded component of the F0 portion of F1F0-ATP synthase. This subunit forms part of the proton channel and plays an essential role in coupling proton translocation across the membrane to ATP synthesis. The protein contains multiple transmembrane domains and interacts with the c-ring rotor component to facilitate the conversion of the proton motive force into mechanical energy for ATP synthesis .

How does the structure of C. hominis atpB compare to that of other bacterial species?

While specific structural data for C. hominis atpB remains limited, comparative genomic analyses suggest it shares structural homology with other epsilonproteobacteria. The protein likely contains 5-6 transmembrane helices with conserved charged residues crucial for proton translocation. Similar to its relatives in the Campylobacter genus, C. hominis atpB likely maintains the conserved arginine residue in the fourth transmembrane helix that is essential for function. Structural conservation is expected to be highest among closely related species like C. jejuni, which has been more extensively studied .

What expression systems are most suitable for recombinant production of C. hominis atpB?

For recombinant production of C. hominis atpB, E. coli-based expression systems with specific modifications for membrane proteins are typically most effective. Due to the hydrophobic nature of atpB, expression strategies should utilize vectors containing fusion tags (such as His6, MBP, or SUMO) to enhance solubility and facilitate purification. Expression in C41(DE3) or C43(DE3) E. coli strains, which are engineered for membrane protein expression, often yields better results than standard BL21(DE3) strains. Induction conditions must be carefully optimized, with lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) typically resulting in higher quality protein production .

What are the most effective purification strategies for recombinant C. hominis atpB?

Purification of recombinant C. hominis atpB requires specialized approaches due to its hydrophobic nature. A multi-step purification protocol typically yields the best results:

  • Membrane fraction isolation using differential centrifugation (40,000-100,000 × g)

  • Solubilization with appropriate detergents (common options listed in Table 1)

  • Affinity chromatography utilizing engineered tags

  • Size exclusion chromatography for final purification

Table 1: Detergents for atpB Solubilization and Their Effectiveness

DetergentConcentration RangeEffectivenessNotes
DDM1-2%HighMaintains protein stability
LMNG0.5-1%HighBetter for crystallization
Triton X-1001-3%ModerateMay affect activity
Digitonin0.5-1%Moderate-HighGentle extraction
SDS0.1-0.5%LowHighly denaturing

For optimal results, extraction buffers should contain stabilizing agents such as glycerol (10-20%) and be maintained at pH 7.5-8.0. Purification should be performed at 4°C to minimize protein degradation, with protease inhibitors added throughout the process .

How can researchers assess the functional activity of purified recombinant C. hominis atpB?

Assessing the functional activity of recombinant atpB presents challenges due to its role as part of the larger ATP synthase complex. Several complementary approaches can be employed:

  • Reconstitution assays: Incorporating purified atpB into liposomes with other ATP synthase components to measure proton translocation.

  • Complementation studies: Testing whether the recombinant protein can restore function in atpB-deficient bacterial strains.

  • Binding assays: Using surface plasmon resonance or other techniques to measure interaction with known binding partners (such as c-subunit).

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm proper secondary structure formation, particularly the predicted alpha-helical content.

For successful reconstitution experiments, the lipid composition should be optimized to mimic the native membrane environment of C. hominis, typically using a mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin .

What mutation strategies can be employed to study structure-function relationships in C. hominis atpB?

Site-directed mutagenesis remains the gold standard for structure-function studies of atpB. Key approaches include:

  • Alanine scanning mutagenesis: Systematically replacing conserved residues with alanine to identify functionally important amino acids.

  • Charge reversal/neutralization: Modifying charged residues involved in proton translocation to assess their contribution to function.

  • Cross-linking studies: Introducing cysteine residues at predicted interaction sites to enable disulfide bond formation with partner proteins.

  • Chimeric protein construction: Creating hybrid proteins containing regions from related species to map species-specific functional domains.

When designing mutagenesis experiments, researchers should focus on the conserved charged residues in transmembrane domains, particularly those aligned with known functional residues in E. coli or other well-characterized ATP synthases. Mutations should be verified by sequencing before functional characterization .

How does temperature adaptation affect C. hominis atpB function compared to thermophilic Campylobacter species?

C. hominis atpB demonstrates mesophilic adaptation patterns distinct from thermophilic Campylobacter relatives. Research indicates that thermal stability of ATP synthase components correlates with organism growth temperature optima. C. hominis atpB typically exhibits lower thermal stability (denaturation beginning at 45-50°C) compared to thermophilic Campylobacter species such as C. jejuni, which maintains stability up to 42°C, the temperature of the avian intestinal tract.

This difference is reflected in several structural adaptations:

  • Lower proline content in transmembrane helices

  • Fewer salt bridges between helical domains

  • Different lipid-protein interactions at membrane interfaces

These adaptations likely represent evolutionary responses to the distinct ecological niches occupied by different Campylobacter species. When designing experiments with recombinant C. hominis atpB, researchers should account for these thermal stability differences by conducting functional assays at temperatures closer to human body temperature rather than the higher temperatures optimal for C. jejuni .

What are the challenges in crystallizing recombinant C. hominis atpB for structural studies?

Crystallization of membrane proteins like atpB presents significant challenges. For C. hominis atpB specifically, researchers should consider:

  • Detergent selection: Detergents that maintain native structure while allowing crystal contacts are crucial. LMNG, DMNG, and DDM with cholesterol hemisuccinate have shown promise for similar proteins.

  • Lipid cubic phase crystallization: This method can provide a more native-like environment for membrane proteins and has proven successful for other ATP synthase components.

  • Stabilizing mutations: Introduction of mutations that enhance thermostability without affecting function can improve crystallization outcomes.

  • Co-crystallization strategies: Attempting crystallization with binding partners or antibody fragments can provide additional lattice contacts.

A significant obstacle is protein heterogeneity, often resulting from flexible regions. Limited proteolysis coupled with mass spectrometry can identify such regions, which can then be removed or modified to enhance crystallization prospects. Recent advances in cryo-electron microscopy may provide an alternative approach for structural determination when crystallization proves challenging .

How do post-translational modifications affect the function of C. hominis atpB in different environmental conditions?

While bacterial ATP synthase components generally undergo fewer post-translational modifications than their eukaryotic counterparts, emerging evidence suggests that modifications may play a regulatory role in C. hominis atpB function. Potential modifications include:

  • Phosphorylation: Particularly of serine/threonine residues in cytoplasmic loops, potentially regulating protein-protein interactions within the ATP synthase complex.

  • Acetylation: Modification of lysine residues might influence proton translocation efficiency.

  • Oxidative modifications: Cysteine residues may form disulfide bonds under oxidative stress, potentially as a regulatory mechanism.

Environmental factors such as pH, oxygen levels, and nutrient availability may influence these modifications. Mass spectrometry-based proteomic approaches are essential for mapping these modifications, requiring careful sample preparation to maintain the native modification state. The functional significance can be assessed by comparing wild-type protein with variants containing mutations at modification sites (e.g., phosphomimetic mutations) .

What strategies help overcome low yield in recombinant expression of C. hominis atpB?

Low protein yield is a common challenge when expressing membrane proteins like atpB. Several strategies can improve expression levels:

  • Codon optimization: Adjusting the coding sequence to match the codon usage bias of the expression host can significantly enhance translation efficiency.

  • Fusion partners: N-terminal fusions with highly expressed proteins like MBP or SUMO can improve folding and expression levels.

  • Chaperone co-expression: Co-expressing molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can assist proper folding.

  • Expression host optimization: Screening multiple expression strains, including C41/C43(DE3), Rosetta, or SHuffle strains to identify optimal conditions.

  • Induction protocol modification: Lowering growth temperature to 16-20°C, reducing IPTG concentration, and extending expression time to 18-24 hours often yields better results.

For particularly challenging constructs, cell-free expression systems using detergent micelles or nanodiscs during translation can produce correctly folded membrane proteins with significantly improved yield .

How can researchers distinguish between functional and non-functional forms of recombinant C. hominis atpB?

Distinguishing functional from non-functional forms requires multiple analytical approaches:

  • Size exclusion chromatography: Properly folded atpB typically elutes as a well-defined peak, while misfolded forms often form aggregates that elute in the void volume.

  • Thermal shift assays: Functional protein demonstrates cooperative unfolding with a distinct melting temperature, while non-functional forms show irregular unfolding patterns.

  • Protease resistance profiling: Correctly folded membrane proteins generally show greater resistance to limited proteolysis than misfolded variants.

  • Detergent exchange tests: Functional atpB remains soluble during exchange to milder detergents, while non-functional forms often precipitate.

  • Negative stain electron microscopy: This can provide visual confirmation of protein homogeneity and proper oligomeric state.

When purifying atpB, researchers should perform these quality control assessments at each step of the purification process to ensure the final product is suitable for functional and structural studies .

What are the specific considerations for studying protein-protein interactions involving C. hominis atpB?

Studying interactions between atpB and other ATP synthase components requires specialized approaches for membrane proteins:

  • Detergent considerations: The choice of detergent is critical, as some detergents may disrupt native interactions. Milder detergents like digitonin or amphipols better preserve protein-protein interactions.

  • Cross-linking strategies: Chemical cross-linking coupled with mass spectrometry (XL-MS) can capture transient interactions and provide distance constraints for structural modeling.

  • Biolayer interferometry: This technique can measure binding kinetics of solubilized atpB with partner proteins and is less sensitive to detergent effects than some alternative methods.

  • Förster resonance energy transfer (FRET): By labeling atpB and potential interaction partners with appropriate fluorophores, researchers can detect interactions both in vitro and in reconstituted systems.

  • Native mass spectrometry: Recent advances allow analysis of intact membrane protein complexes in detergent micelles, providing information about stoichiometry and stability.

For integration into functional ATP synthase complexes, co-expression strategies often yield better results than attempting to assemble complexes from individually purified components .

How does atpB function contribute to C. hominis stress response and survival?

ATP synthase function is critical for energy metabolism and adaptation to environmental stresses. For C. hominis, atpB function directly impacts several stress response mechanisms:

  • pH tolerance: The proton-translocating function of atpB contributes to cytoplasmic pH homeostasis, similar to the role of ATP-dependent proteases like Lon and ClpP in other Campylobacter species in responding to environmental stress .

  • Temperature adaptation: Unlike C. jejuni, which requires ClpP and ClpX for growth at 42°C (the temperature of the avian intestinal tract), C. hominis atpB is adapted to function optimally at human body temperature (37°C) .

  • Energy conservation during stress: Under nutrient limitation, ATP synthase efficiency becomes critical for survival, with atpB function directly impacting the cell's ability to maintain essential processes.

  • Oxidative stress response: Proper ATP generation via functional atpB provides energy for antioxidant defense systems to combat oxidative damage.

Research suggests that like other stress-response proteins in Campylobacter, atpB function may be regulated by environmental signals through mechanisms that are still being elucidated .

What role does atpB play in C. hominis virulence and host colonization?

While direct evidence for atpB's role in C. hominis virulence is limited, comparative analysis with other Campylobacter species provides important insights:

  • Energy production for virulence processes: Functional ATP synthase is essential for powering flagellar motility, a critical virulence factor in Campylobacter species. As demonstrated in C. jejuni, loss of motility significantly reduces virulence and colonization ability in mouse models .

  • Adaptation to host environments: The ability to maintain ATP synthesis under the varying conditions encountered during host colonization (changing pH, oxygen levels, nutrient availability) is likely dependent on properly functioning atpB.

  • Potential target for antimicrobial development: The essential nature of ATP synthase for bacterial survival makes atpB a potential target for novel antimicrobials, similar to how ClpP and ClpX have been identified as potential targets for intervention strategies aimed at reducing C. jejuni in poultry production .

  • Contribution to stress tolerance during infection: Similar to how ATP-dependent proteases influence heat tolerance and virulence-associated phenotypes in C. jejuni, properly functioning atpB may help C. hominis survive host defense mechanisms .

Further research using atpB mutants in appropriate infection models is needed to fully elucidate its specific contributions to virulence .

What statistical approaches are most appropriate for analyzing atpB functional data from different experimental designs?

The analysis of atpB functional data requires careful statistical consideration:

  • Enzyme kinetics data: Non-linear regression analysis is typically required to determine parameters like Km and Vmax. The Michaelis-Menten equation or more complex models may be appropriate depending on the assay design.

  • Comparative analysis across mutants: ANOVA with appropriate post-hoc tests (Tukey's or Dunnett's) is recommended when comparing multiple atpB variants to wild-type protein.

  • Time-course experiments: Repeated measures ANOVA or mixed-effects models should be employed to account for time-dependent changes in protein activity.

  • Thermal stability data: Boltzmann sigmoid equation fitting is standard for thermal shift assays, allowing determination of melting temperatures (Tm).

  • Protein-protein interaction studies: For binding assays, models based on the law of mass action (such as one-site or two-site binding models) are typically applied.

Sample size determination should be based on power analysis, with typical experimental designs requiring at least 3-5 biological replicates to detect meaningful differences. When reporting results, researchers should include measures of dispersion (standard deviation or standard error) and clearly indicate the statistical tests applied .

How can researchers reconcile contradictory findings about C. hominis atpB function from different experimental approaches?

Contradictory findings regarding atpB function may arise from various sources, requiring systematic investigation:

  • Methodological differences: Variation in purification methods, detergent choice, or assay conditions can lead to apparently contradictory results. Researchers should carefully compare protocols and attempt to standardize critical parameters.

  • Protein quality variation: Differences in protein folding, oligomeric state, or post-translational modifications can affect function. Quality control metrics should be reported alongside functional data.

  • Context-dependent function: atpB may behave differently in isolation versus as part of the complete ATP synthase complex. Reconstitution studies may provide more physiologically relevant information than assays with isolated protein.

  • Data integration approaches: Bayesian statistical methods can be valuable for integrating data from diverse experimental approaches, giving appropriate weight to results based on their reliability and consistency.

  • Collaborative validation: When contradictory findings persist, collaborative studies between laboratories using identical protein preparations but different analytical techniques can help resolve discrepancies.

When publishing, researchers should acknowledge limitations of their experimental approaches and discuss how their findings relate to previous reports, particularly when contradictions arise .

What are the emerging technologies that could advance our understanding of C. hominis atpB structure and function?

Several cutting-edge technologies hold promise for advancing research on C. hominis atpB:

  • Cryo-electron microscopy: Recent advances in detector technology and image processing have revolutionized structural studies of membrane proteins, potentially enabling high-resolution structures of atpB within the ATP synthase complex without crystallization.

  • Single-molecule techniques: Approaches such as single-molecule FRET and high-speed atomic force microscopy can provide insights into the dynamics of atpB function that are impossible to obtain from ensemble measurements.

  • Nanodiscs and SMALPs: These technologies provide more native-like membrane environments for functional studies compared to detergent micelles, potentially revealing aspects of atpB function missed in conventional studies.

  • Deep mutational scanning: This approach enables simultaneous functional assessment of thousands of atpB variants, providing comprehensive insight into sequence-function relationships.

  • In-cell NMR: Emerging techniques for studying membrane proteins in living cells may eventually allow observation of atpB dynamics under physiological conditions.

  • Computational approaches: Improved molecular dynamics simulations of membrane proteins, particularly when informed by experimental constraints, can provide mechanistic insights into proton translocation and protein-protein interactions .

What are the potential applications of recombinant C. hominis atpB in biomedical research?

Recombinant C. hominis atpB has several potential applications in biomedical research:

  • Antimicrobial development: As an essential component of energy metabolism, atpB represents a potential target for new antimicrobials. High-throughput screening assays using purified recombinant protein could identify inhibitors with therapeutic potential.

  • Vaccine development: Understanding the structure and surface-exposed regions of atpB could inform the design of vaccines targeting C. hominis, particularly if portions of the protein are accessible to the immune system.

  • Diagnostic tools: Antibodies raised against recombinant atpB could be used in diagnostic tests for C. hominis infection, potentially improving clinical detection.

  • Fundamental bioenergetics research: As a model F-type ATP synthase component, studies of C. hominis atpB can contribute to our broader understanding of proton-coupled energy transduction in biological systems.

  • Drug delivery systems: Modified ATP synthase components have been explored as potential drug delivery vehicles; engineered C. hominis atpB could potentially be developed for similar applications.

While these applications remain largely theoretical, the foundational research using recombinant protein is an essential first step toward these potential biomedical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.