Recombinant Campylobacter hominis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; CHAB381_1381; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A)
Target Names
mscL
Target Protein Sequence
MSFIKEFKEFAVKGNVIDMAVGVVIGSAFGKIVSSLVGDVIMPVVGVLTGGVNFTDLKIT IKEAVGENAAVTINYGNFIQVTIDFLIIAFCIFLAIKAINQLKKPEKQEPKAPAEPNDEV KLLSEIRDLLKK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

Technical Considerations

  • What are the optimal storage and handling conditions for recombinant C. hominis MscL protein?

    Proper storage and handling are critical for maintaining the functionality of recombinant MscL protein:

    a) Storage Conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • For working solutions, store at 4°C for up to one week

    b) Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage (50% is recommended)

    c) Buffer Considerations:

    • Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is suitable for storage

    • When using for functional studies, consider the impact of buffer components on membrane properties

    d) Quality Control:

    • Verify protein integrity by SDS-PAGE before use

    • For functional studies, periodically confirm channel activity

  • What controls should be included when testing C. hominis MscL activity in experimental systems?

    Robust experimental design requires appropriate controls:

    a) Negative Controls:

    • Inactive MscL mutants (e.g., deletion of critical residues)

    • Empty vector controls for expression systems

    • Untransfected/untreated cells in mammalian expression systems

    • Wild-type bacteria without MscL for functional complementation studies

    b) Positive Controls:

    • Well-characterized MscL variants with known activity (e.g., E. coli MscL)

    • Chemical activators that can trigger channel opening independently of mechanical force

    • Parent strains with antibiotic markers for recombination assays

    c) Experimental Validation:

    • PCR verification of genetic constructs using locus-specific primers

    • Western blotting to confirm protein expression

    • Patch clamp recordings to directly verify channel activity

    d) System-Specific Controls:

    • For osmotic shock experiments: osmolarity measurements before and after shock

    • For fluorescent dye uptake: controls for membrane integrity

    • For recombination assays: DNase treatment to confirm DNA-dependent mechanisms

  • How can the purity and functionality of recombinant C. hominis MscL be verified?

    Multiple approaches can verify both purity and functionality:

    a) Purity Assessment:

    • SDS-PAGE analysis (>90% purity is generally suitable for functional studies)

    • Size exclusion chromatography to verify oligomeric state

    • Mass spectrometry to confirm protein identity and detect modifications

    b) Structural Integrity:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Native PAGE to verify pentameric assembly

    • Negative-stain electron microscopy for visual confirmation of structure

    c) Functional Verification:

    • Patch clamp electrophysiology in reconstituted systems

    • Liposome swelling assays to measure channel activity

    • Fluorescent dye uptake in cells expressing the recombinant protein

    • Complementation of MscL-deficient bacterial strains

    d) Practical Workflow:

    1. Initial purity assessment by SDS-PAGE

    2. Structural verification by size exclusion chromatography

    3. Functional testing in an appropriate membrane system

    4. Comparison to well-characterized MscL variants (e.g., E. coli MscL)

  • What are the applications of recombinant C. hominis MscL in studying bacterial pathogenesis and developing novel antimicrobials?

    Recombinant C. hominis MscL has several research and therapeutic applications:

    a) Understanding Bacterial Adaptation:

    • Study how C. hominis survives osmotic stress during colonization

    • Investigate the role of MscL in environmental persistence and transmission

    • Examine potential contributions to inflammatory bowel disease pathogenesis

    b) Antimicrobial Development:

    • MscL represents a potential target for novel antibiotics against Campylobacter species

    • Compounds that inappropriately trigger MscL opening could disrupt bacterial osmotic balance

    • Species-specific MscL variations could enable targeted antimicrobial approaches

    c) Experimental Tools:

    • Use as a model system for studying mechanosensation mechanisms

    • Development of biosensors for detecting membrane perturbations

    • Gene delivery applications in experimental systems

    d) Methodological Applications:

    • Investigation of horizontal gene transfer mechanisms in Campylobacter species

    • Study of bacterial membrane properties in different environments

    • Exploration of host-pathogen interactions at the membrane level

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.