Recombinant Campylobacter hominis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Properties

PropertyDetails
Gene NamenuoK (CHAB381_0191)
Protein Length101 amino acids
Molecular Weight~11.3 kDa (calculated)
DomainsTransmembrane helices (predicted)
Redox CofactorsIron-sulfur clusters (indirect role via Complex I)

Recombinant Production

Recombinant nuoK is produced using heterologous expression systems for biochemical and structural studies:

  • Expression Hosts: Escherichia coli, baculovirus, or mammalian cells .

  • Purification: Tags (e.g., His-tag) facilitate affinity chromatography, yielding >85% purity .

  • Storage: Lyophilized or in Tris/PBS buffer with 50% glycerol at -20°C/-80°C .

Research Applications

Recombinant nuoK is pivotal in:

  • Respiratory Chain Studies: Elucidating electron transfer mechanisms in Campylobacter, which lacks traditional NADH dehydrogenase subunits (e.g., nuoE, nuoF) .

  • Essential Gene Analysis: nuoK homologs in C. jejuni are indispensable, as deletions impair α-ketoglutarate respiration .

  • Vaccine Development: Investigated as a potential antigen due to its surface exposure in pathogenic Campylobacter species .

Functional Insights

  • Electron Acceptor Role: In C. jejuni, flavodoxin acts as the electron acceptor for α-ketoglutarate:acceptor oxidoreductase (OOR), linking nuoK to flavodoxin-mediated respiration .

  • Essentiality: Both nuoK and flavodoxin (fldA) are essential genes, highlighting their non-redundant roles in central metabolism .

Challenges and Future Directions

  • Structural Resolution: The membrane-bound nature of nuoK complicates crystallography studies .

  • Therapeutic Targeting: Its conservation in pathogenic Campylobacter spp. makes it a candidate for antimicrobial drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; CHAB381_0191; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A)
Target Names
nuoK
Target Protein Sequence
MISLNHYLIVAALMFVIGLVGVMKRQNLIMLFFSTEILLNAANVALVAISSFYNDIGGQI FAMFIIAIAASEMAVGLGLLILWYKKRHSIEIDSLSTMRDE
Uniprot No.

Target Background

Function

NDH-1 transfers electrons from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, the primary electron acceptor is believed to be ubiquinone. The enzyme couples this redox reaction to proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NADH-quinone oxidoreductase function differ between Campylobacter species?

Significant variations exist in NADH-quinone oxidoreductase structure and function across Campylobacter species. C. jejuni and C. coli utilize a modified Complex I system that employs flavodoxin and menaquinone as electron carriers rather than the canonical NADH and ubiquinone . This adaptation is facilitated by specific mutations in nuoC-E genes. In contrast, species like C. hyointestinalis and C. fetus maintain the traditional NADH/ubiquinone system . Most remarkably, several Campylobacter species completely lack genes for Complex I assembly, suggesting entirely different respiratory mechanisms . When studying C. hominis nuoK, researchers should perform comparative genomic analyses to determine which respiratory pattern this species follows, as this will fundamentally affect experimental design and interpretation.

What expression systems are optimal for producing recombinant Campylobacter nuoK proteins?

For recombinant expression of membrane proteins like nuoK from Campylobacter species, E. coli remains a common host system, though expression can be challenging due to the hydrophobic nature of membrane proteins. Based on standard protocols for similar proteins, researchers should consider specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) . Alternative expression systems including yeast, baculovirus, or mammalian cell systems may be necessary if E. coli expression proves problematic . For optimal yield and function, expression constructs should include affinity tags positioned to avoid interference with protein folding, and expression conditions (temperature, inducer concentration, duration) should be systematically optimized for each target protein.

How do mutations in nuoK affect proton translocation and energy conservation in Campylobacter species?

Mutations in nuoK would likely significantly impact the proton translocation mechanism of Complex I in Campylobacter species. In C. jejuni, whose nuo operon lacks the traditional NADH dehydrogenase components (nuoE and nuoF) but contains all membrane components including nuoK, disruption of nuo genes prevents growth in amino acid-based media unless supplemented with alternative respiratory substrates like formate . To experimentally investigate nuoK mutations in C. hominis, researchers should:

  • Generate site-directed mutations in conserved residues predicted to participate in proton channels

  • Develop complementation systems using intact nuoK copies provided at unrelated chromosomal sites

  • Measure membrane potential using fluorescent probes (e.g., DiSC3(5))

  • Quantify growth rates in defined media with various electron donors

  • Perform oxygen consumption assays with specific substrates

These approaches would reveal whether nuoK mutations compromise proton translocation independently of electron transfer, potentially identifying residues essential for coupling these processes.

What methodological approaches are most effective for studying the interaction between nuoK and other Complex I subunits?

To effectively study interactions between nuoK and other Complex I subunits in Campylobacter species, researchers should employ multiple complementary approaches:

  • Crosslinking studies: Using homo- or hetero-bifunctional crosslinkers to capture transient protein-protein interactions within the complex, followed by mass spectrometry to identify interaction partners

  • Co-immunoprecipitation: Developing specific antibodies against nuoK or utilizing epitope-tagged versions to pull down interaction partners

  • Bacterial two-hybrid systems: Adapted for membrane protein interactions to detect binary interactions between nuoK and other subunits

  • Cryo-electron microscopy: For structural determination of the entire complex, revealing the precise positioning of nuoK within the membrane domain

  • Molecular dynamics simulations: Using available structural data to predict dynamic interactions between subunits

These approaches should be complemented with mutagenesis studies targeting predicted interaction interfaces to validate functional significance of observed interactions .

How does flavodoxin-dependent electron transfer affect the function of Complex I in Campylobacter species lacking traditional NADH dehydrogenase components?

In C. jejuni, the absence of traditional NADH dehydrogenase components (nuoE and nuoF) has led to an alternative electron input mechanism involving flavodoxin. Research indicates that flavodoxin serves as an electron carrier that connects central metabolism to the respiratory chain, with proteins like CJ1574 mediating electron flow from reduced flavodoxin into Complex I . To investigate the implications for C. hominis nuoK:

  • Determine whether C. hominis utilizes the flavodoxin-dependent pathway by genomic analysis

  • If present, characterize the redox potentials of flavodoxin and Complex I components to establish thermodynamic feasibility of electron transfer

  • Perform enzyme kinetics assays with purified components to measure electron transfer rates

  • Develop a reconstituted system in proteoliposomes to measure proton translocation coupled to flavodoxin oxidation

  • Compare energy conservation efficiency between flavodoxin-dependent and NADH-dependent systems

What purification strategies maximize yield and stability of recombinant nuoK for structural studies?

Purification of recombinant nuoK presents significant challenges due to its hydrophobic nature and membrane integration. A comprehensive purification strategy should include:

  • Detergent screening: Systematically test multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization without denaturing the protein

  • Two-phase extraction protocol:

    • Membrane isolation via ultracentrifugation

    • Selective solubilization with optimized detergent concentrations

    • Affinity chromatography using His-tag or other fusion tags

    • Size exclusion chromatography for final polishing

  • Stability optimization:

    • Addition of specific phospholipids (e.g., cardiolipin) to maintain native-like environment

    • Inclusion of appropriate quinone analogs to stabilize binding sites

    • Temperature control throughout purification (typically 4°C)

  • Quality assessment:

    • Circular dichroism to confirm secondary structure integrity

    • Fluorescence spectroscopy to assess tertiary structure

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

These approaches should be tailored specifically to nuoK, with particular attention to maintaining the native fold while removing contaminating proteins .

What are the most reliable assays for measuring electron transfer activity in Campylobacter Complex I containing recombinant nuoK?

To reliably measure electron transfer activity in Campylobacter Complex I containing recombinant nuoK, researchers should employ multiple complementary assays:

  • Spectrophotometric assays:

    • NADH oxidation monitoring (if applicable) at 340 nm

    • For flavodoxin-dependent systems, monitor flavodoxin oxidation state changes

    • Quinone reduction measured at appropriate wavelengths for the specific quinone

  • Oxygen consumption measurements:

    • Clark-type electrode assays with isolated membranes

    • Addition of specific inhibitors to differentiate Complex I activity from other oxidases

  • Artificial electron acceptor assays:

    • Using ferricyanide or other artificial electron acceptors as alternative readouts

    • Allows isolation of specific electron transfer steps

  • Membrane potential measurements:

    • Fluorescence-based assays using potential-sensitive dyes

    • Correlation between electron transfer and proton pumping efficiency

  • Reconstituted proteoliposome assays:

    • Incorporation of purified complex into liposomes

    • Measurement of proton translocation coupled to electron transfer

When studying C. hominis nuoK, these assays should be adapted based on whether the organism uses the flavodoxin-dependent pathway observed in C. jejuni or a more canonical electron transfer system .

How should researchers interpret conflicting data between in vitro and in vivo functional studies of nuoK?

When facing discrepancies between in vitro and in vivo functional studies of nuoK, researchers should systematically address potential sources of these conflicts:

  • Reconstitution adequacy assessment:

    • Verify proper incorporation and orientation in membrane systems

    • Confirm presence of all necessary cofactors and lipid components

    • Assess whether detergents used for purification affect function

  • Physiological context differences:

    • In vivo studies capture regulatory mechanisms absent in vitro

    • Metabolic state of cells affects respiratory chain composition and activity

    • Alternative electron pathways may compensate for deficiencies in vivo

  • Resolution approaches:

    • Perform complementation studies with wild-type nuoK in knockout strains

    • Use partially purified membrane fragments to bridge the gap between purified and in vivo systems

    • Develop conditional expression systems to study transition states

    • Combine mutational analysis with both in vitro and in vivo readouts

  • Data integration framework:

    • Develop mathematical models incorporating both datasets

    • Identify specific conditions where discrepancies emerge or resolve

    • Consider evolutionary context of the specific Campylobacter species studied

This systematic approach facilitates reconciliation of seemingly contradictory results and provides deeper insights into nuoK function within its native cellular environment .

What bioinformatic approaches best identify functional residues in nuoK across Campylobacter species?

To identify functional residues in nuoK across Campylobacter species, researchers should implement a comprehensive bioinformatic workflow:

  • Multiple sequence alignment pipeline:

    • Collect nuoK sequences from diverse Campylobacter species

    • Include sequences from better-characterized bacterial species as references

    • Use membrane protein-specific alignment algorithms (e.g., PRALINE)

    • Manually refine alignments in transmembrane regions

  • Conservation analysis:

    • Calculate conservation scores using methods that account for physicochemical properties

    • Identify absolutely conserved residues across all species

    • Detect residues conserved specifically within Campylobacter compared to other bacteria

  • Structural prediction and analysis:

    • Generate homology models based on available Complex I structures

    • Identify residues lining potential proton channels

    • Detect potential quinone binding regions

    • Identify subunit interface residues

  • Coevolution analysis:

    • Apply statistical coupling analysis to detect co-evolving residue networks

    • Identify potential functional coupling between distant residues

  • Integrative scoring system:

    • Combine conservation, structural position, and coevolution data

    • Prioritize residues for experimental validation

    • Generate testable hypotheses about function

This approach would enable systematic identification of residues potentially involved in proton translocation, subunit interactions, and other key functions of nuoK .

How has the nuoK subunit evolved across Campylobacter species with different electron transport chain configurations?

The evolution of nuoK across Campylobacter species presents a fascinating case study in respiratory chain adaptation. Based on the available data:

  • Evolutionary patterns observable in Campylobacter:

    • Canonical complex I species (C. hyointestinalis, C. fetus) maintain traditional nuoK structure

    • Modified complex I species (C. jejuni, C. coli) show conserved nuoK despite alterations in electron input subunits

    • Complex I-lacking species have completely lost nuoK along with other complex components

  • Selective pressures and adaptations:

    • Membrane-embedded subunits like nuoK typically evolve more slowly than peripheral components

    • Conservation patterns likely reflect constraints on proton translocation machinery

    • Amino acid substitutions may reflect adaptations to different membrane compositions or energetic requirements

  • Methodological approaches for evolutionary analysis:

    • Calculate Ka/Ks ratios to identify selection signatures

    • Perform ancestral sequence reconstruction to trace evolutionary trajectories

    • Conduct phylogenetic analyses comparing nuoK evolution to whole-genome phylogenies

    • Map sequence variations onto structural models to identify functional implications

These evolutionary patterns provide crucial context for understanding C. hominis nuoK function and can guide experimental design by highlighting conserved features likely essential for function versus variable regions potentially involved in species-specific adaptations .

What functional differences exist between nuoK from Campylobacter species that use flavodoxin versus those that use traditional NADH dehydrogenase systems?

The functional differences between nuoK from Campylobacter species with different electron input systems likely reflect adaptations to distinct energetic constraints:

  • Proton translocation efficiency:

    • Flavodoxin-dependent systems may require adjustments in coupling efficiency

    • Differences in redox potential between electron donors could necessitate structural adaptations in membrane components

  • Regulatory interfaces:

    • Traditional NADH-dependent systems may contain regulatory sites absent in flavodoxin-dependent complexes

    • Alternative regulatory mechanisms may have evolved in species lacking traditional input modules

  • Subunit interactions:

    • Interface residues between nuoK and adjacent subunits may show adaptations reflecting different complex architectures

    • Energy transfer pathways through the membrane domain might be reconfigured

  • Research strategies to investigate these differences:

    • Chimeric constructs swapping nuoK between species with different electron input systems

    • Site-directed mutagenesis targeting residues unique to each system

    • Comparative structural studies using cryo-EM to detect conformational differences

    • Functional assays comparing proton translocation efficiency between systems

Understanding these differences is crucial for correctly interpreting experimental results with C. hominis nuoK and predicting its functional properties based on its evolutionary relationship to better-characterized Campylobacter species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.