Recombinant Campylobacter jejuni ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in C. jejuni

The ATP synthase complex, including subunit a, is essential for energy production via proton translocation across the bacterial membrane. Key functions include:

  • Energy metabolism: Facilitates ATP synthesis during oxidative phosphorylation, critical for survival under aerobic and host-associated conditions .

  • Stress adaptation: Indirectly linked to stress tolerance (e.g., oxidative, osmotic) by maintaining cellular energy homeostasis .

  • Genetic diversity: The atpB gene exhibits allelic variation across C. jejuni strains, contributing to genomic plasticity and adaptation .

Recombinant Expression Systems

The protein is expressed using plasmid vectors (e.g., pET32) in E. coli, followed by purification via metal affinity chromatography . Refolding techniques, such as urea gradient dialysis, ensure proper conformational structure .

ParameterDetails
Expression vectorpET32
Host strainE. coli BL21
Purification methodNickel-nitrilotriacetic acid (Ni-NTA) chromatography
YieldHigh solubility due to thioredoxin fusion tags

Vaccine Development

Recombinant atpB is explored as a vaccine antigen due to its surface exposure and conservation across C. jejuni strains. For example:

  • Antigenicity: Elicits immune responses in preclinical models, though efficacy data remain limited .

  • Diagnostics: Used in immunoassays to detect C. jejuni antibodies in infected hosts .

Functional Studies

  • Genetic complementation: The C. jejuni ATP synthase system has been used to study homologous recombination in E. coli .

  • Stress response assays: Mutants lacking atpB show altered resistance to oxidative and osmotic stress .

Key Research Findings

  1. Allelic diversity: Multilocus sequence typing (MLST) revealed low nonsynonymous polymorphism in atpB, suggesting purifying selection .

  2. Recombination frequency: Horizontal gene transfer (HGT) involving atpB occurs at 0.028% efficiency in vitro, increasing 10-fold in chicken cecal environments .

  3. Host interactions: Deletion of ABC transporter components (e.g., paqP/paqQ) adjacent to atpB reduces host cell death, implicating metabolic genes in immune evasion .

Future Directions

  • Structural studies: Cryo-EM analysis to resolve ATP synthase complex architecture.

  • Therapeutic targeting: Screen inhibitors against atpB to disrupt bacterial energy metabolism.

  • Epidemiology: Expand MLST databases to track atpB alleles in global C. jejuni outbreaks.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; CJE1338; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
atpB
Target Protein Sequence
MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVPRGMQNLGEAFLEGVL SMGRDTMGSEKGARKYLPLVATLGIIVFFSNIIGIIPGFHSPTASLNLTLSLAIIVFVYY HFEGIRAQGFVKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMV ILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVVEEGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in proton translocation across the membrane.
Database Links

KEGG: cjr:CJE1338

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Campylobacter jejuni metabolism?

ATP synthase subunit a (atpB) in C. jejuni is a critical component of the F₀ portion of F₁F₀-ATP synthase, the enzyme complex responsible for ATP synthesis through oxidative phosphorylation. This protein plays an essential role in proton translocation across the bacterial membrane, which drives the synthesis of ATP. In C. jejuni, ATP synthase is particularly interesting because the organism has an absolute requirement for oxygen despite being able to operate the electron transport chain anaerobically . This microaerophilic nature makes the study of ATP synthase function particularly relevant to understanding C. jejuni's unique metabolic adaptations. The ATP synthase complex is integral to energy production in this pathogen, which must survive in various environments during transmission and infection, including water reservoirs, food-processing plants, and the gastrointestinal tracts of poultry and humans .

What methods are commonly used to express recombinant C. jejuni atpB for research purposes?

Expression of recombinant C. jejuni atpB typically involves several methodological steps:

  • Gene amplification and cloning: The atpB gene is amplified from C. jejuni genomic DNA using PCR with specific primers. This approach is similar to techniques used for other C. jejuni genes, where chromosomal DNA is prepared from freshly grown cultures and amplified in reaction mixtures using appropriate polymerases and primers .

  • Expression vector selection: For membrane proteins like atpB, specialized expression vectors with inducible promoters are preferred. Common systems include pET vectors with T7 promoters for E. coli expression.

  • Host selection: E. coli strains like BL21(DE3) or C41(DE3) are often used for membrane protein expression. The latter is especially useful for potentially toxic membrane proteins.

  • Expression optimization: Given C. jejuni's different codon usage compared to E. coli, codon optimization or co-expression with rare tRNAs may be necessary. Additionally, expression at lower temperatures (16-20°C) often improves folding of membrane proteins.

  • Membrane extraction and purification: Detergent-based extraction methods using mild detergents like n-dodecyl-β-D-maltoside (DDM) are typically employed for isolating membrane proteins while maintaining their native conformation.

The expressed protein can be verified using Western blot analysis with specific antibodies, similar to analytical techniques used in C. jejuni research .

How does ATP synthase function relate to C. jejuni's microaerophilic growth requirements?

C. jejuni exhibits the unusual characteristic of requiring oxygen for growth despite its ability to function anaerobically. Recent metabolic modeling studies have provided insight into this paradox. The microaerophilic nature of C. jejuni can be explained by the dependence of enzymes like pyridoxine 5′-phosphate oxidase for the synthesis of pyridoxal 5′-phosphate (vitamin B6) . ATP synthase plays a crucial role in this context by:

  • Balancing energy needs: ATP synthase must function efficiently at low oxygen levels to maintain energy production.

  • Adapting to varying oxygen concentrations: As C. jejuni moves through different environments during infection and transmission, ATP synthase must adapt to changing oxygen availability.

  • Supporting oxidative stress response: Under oxygen-limited conditions, C. jejuni increases its natural transformation capabilities, potentially impacting gene transfer of stress response elements .

Metabolic flux analysis has demonstrated that C. jejuni optimizes its electron transport chain and ATP synthesis pathways to function within its narrow preferred oxygen range (5% O₂) . This optimization includes tight regulation of ATP synthase components, including atpB, to maintain energy production while avoiding oxidative damage.

What isolation and purification strategies yield the highest purity recombinant atpB protein?

For optimal isolation and purification of recombinant C. jejuni atpB protein, a multi-step protocol yields the highest purity:

  • Membrane fraction isolation: After cell lysis, differential centrifugation separates the membrane fraction containing atpB.

  • Detergent solubilization: Membrane proteins require careful selection of detergents. For ATP synthase components, n-dodecyl-β-D-maltoside (DDM) or digitonin are typically effective while preserving protein structure.

  • Affinity chromatography: Using His-tagged constructs allows for immobilized metal affinity chromatography (IMAC) purification. For atpB, incorporating a TEV protease cleavage site between the tag and protein can facilitate tag removal post-purification.

  • Size exclusion chromatography: This step removes aggregates and further purifies the protein based on size.

  • Ion exchange chromatography: A final polishing step often employing anion exchange chromatography.

Protein purity can be assessed using SDS-PAGE and Western blotting, similar to analytical techniques used in studies of other C. jejuni membrane proteins . Mass spectrometry can confirm protein identity and detect post-translational modifications. Typical yields range from 0.5-2 mg of purified protein per liter of bacterial culture, with purity exceeding 95%.

How can recombinant atpB be used to investigate C. jejuni pathogenesis mechanisms?

Recombinant atpB can serve as a valuable tool for investigating C. jejuni pathogenesis through several sophisticated approaches:

  • Structure-function analysis: High-resolution structural studies of purified atpB can reveal unique features that contribute to C. jejuni's ability to survive in diverse environments. Crystal structures or cryo-EM analysis can identify potential drug-binding sites.

  • Protein-protein interaction studies: Using techniques like pull-down assays with recombinant atpB as bait can identify interaction partners within the bacterial cell or with host proteins. This can reveal how ATP synthase components might interact with virulence factors.

  • Host response analysis: Purified atpB can be used to stimulate host cells to assess immune recognition and response, similar to studies with other C. jejuni components that have shown distinct host cell responses . For example, macrophages could be exposed to recombinant atpB to measure cytokine production or signal transduction.

  • Antibody development: Recombinant atpB can be used to generate specific antibodies for immunolocalization studies, tracking ATP synthase distribution during different growth conditions or infection stages.

  • Vaccine potential assessment: As a conserved membrane protein, atpB could potentially serve as a vaccine candidate. Recombinant protein allows for immunization studies in animal models to assess protective efficacy.

These approaches align with established C. jejuni research methodologies, where proteins are often studied to understand bacterial stress responses and host cell interactions .

What techniques can assess the impact of atpB mutations on C. jejuni bioenergetics?

To comprehensively evaluate how atpB mutations affect C. jejuni bioenergetics, researchers can employ several complementary techniques:

Mutation TypeExpected Impact on ATP SynthesisExpected Impact on GrowthExpected Impact on Stress Tolerance
Proton channel residuesSevere reductionSignificant growth defectIncreased sensitivity to multiple stresses
Subunit interface residuesModerate reductionModerate growth defectVariable, depending on specific stress
Peripheral residuesMinimal to noneMinimal to noneMinimal to none

These approaches can provide detailed insights into how atpB structure relates to C. jejuni's unique metabolic adaptations and survival strategies.

How does C. jejuni ATP synthase structure-function differ from other bacterial species?

C. jejuni ATP synthase exhibits several structural and functional distinctions from other bacterial species that reflect its unique ecological niche and metabolic requirements:

  • Proton binding sites: Preliminary structural analyses suggest C. jejuni atpB may have modifications in key proton-binding residues that optimize function at lower oxygen tensions.

  • Subunit interactions: The interface between atpB and other F₀ subunits appears to be adapted for stability under fluctuating environmental conditions encountered during transmission and infection.

  • Regulatory elements: C. jejuni ATP synthase components contain unique regulatory sites that may allow for rapid adaptation to changing oxygen levels, consistent with its microaerophilic nature .

  • Temperature adaptation: Given C. jejuni's growth temperature range (37-42°C), its ATP synthase shows structural adaptations for thermostability different from mesophilic bacteria.

  • Inhibitor sensitivity: C. jejuni ATP synthase demonstrates different sensitivity profiles to known inhibitors compared to other enteric bacteria, reflecting evolutionary adaptations.

Functional studies have revealed that C. jejuni ATP synthase activity is more tightly linked to oxygen availability than in many other bacteria, consistent with metabolic modeling showing the organism's unique oxygen requirements despite anaerobic electron transport chain capability . These distinctive characteristics make C. jejuni ATP synthase an interesting target for comparative structural biology and potentially for pathogen-specific inhibitor development.

What is the relationship between ATP synthase function and antibiotic resistance in C. jejuni?

The relationship between ATP synthase function and antibiotic resistance in C. jejuni involves complex interactions between energy metabolism, stress responses, and resistance mechanisms:

Experimental evidence suggests that targeting bacterial energy metabolism, including ATP synthase, may be a promising strategy to combat antibiotic resistance. For example, some phenolic compounds that affect membrane energetics have been shown to enhance antibiotic efficacy against C. jejuni by impacting both antimicrobial influx and efflux mechanisms .

What approaches can optimize recombinant atpB for structural studies?

Optimizing recombinant C. jejuni atpB for structural studies requires addressing several challenges specific to membrane proteins:

  • Expression system selection: While E. coli is commonly used, more specialized systems may yield better results:

    • Cell-free expression systems can produce membrane proteins directly in the presence of detergents or lipids

    • C43(DE3) or Lemo21(DE3) E. coli strains engineered for toxic membrane protein expression

    • Insect cell expression for complex membrane proteins requiring eukaryotic machinery

  • Fusion partner strategy:

    • GFP fusion can monitor expression, folding, and membrane integration in real-time

    • MBP or other solubility-enhancing tags can improve yields

    • SUMO tag can enhance expression and be precisely removed by SUMO protease

  • Lipid environment reconstitution:

    • Nanodiscs with defined lipid composition for a native-like membrane environment

    • Amphipols as detergent alternatives for stabilizing membrane proteins

    • Lipid cubic phase for crystallization trials

  • Stabilization techniques:

    • Thermostability assays to identify optimal buffer conditions

    • Addition of specific lipids found in C. jejuni membranes

    • Binding partners or antibody fragments to stabilize flexible regions

  • Quality control metrics:

    • Circular dichroism to verify secondary structure

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

    • Thermal shift assays to assess protein stability

ApproachAdvantagesLimitationsYield Expectation
E. coli with optimized inductionSimplicity, cost-effectiveMay form inclusion bodies0.5-2 mg/L
Cell-free expressionRapid, directly in detergentHigher cost, smaller scale0.1-0.5 mg/mL reaction
Insect cell expressionBetter folding, post-translational modificationsTime-consuming, complex1-5 mg/L
Nanodiscs reconstitutionNative-like environmentAdditional reconstitution step70-90% recovery from purified protein

These approaches have been successful for structural studies of membrane proteins from other bacterial species and can be adapted for C. jejuni atpB based on its specific characteristics and research requirements.

How can researchers differentiate between functional effects of atpB mutations versus global metabolic changes?

Distinguishing direct functional effects of atpB mutations from secondary metabolic adaptations requires a multi-faceted experimental approach:

These approaches collectively provide a robust framework for distinguishing primary functional impacts of atpB mutations from secondary metabolic adaptations, enabling more precise interpretation of experimental results.

What considerations are important when designing antibodies against C. jejuni atpB?

Developing effective antibodies against C. jejuni atpB requires careful consideration of several factors:

  • Epitope selection strategy:

    • Analyze atpB sequence using epitope prediction algorithms to identify exposed regions

    • Focus on C. jejuni-specific regions that differ from commensal bacteria

    • Consider both linear epitopes (for Western blotting) and conformational epitopes (for native protein detection)

    • Avoid transmembrane domains, which are poorly immunogenic and inaccessible in intact cells

  • Immunization considerations:

    • Use purified recombinant fragments rather than whole protein to focus immune response on accessible epitopes

    • Consider multiple host species (rabbit, mouse, chicken) as they may recognize different immunodominant epitopes

    • Use adjuvants appropriate for membrane proteins to enhance immunogenicity

  • Validation requirements:

    • Test against recombinant protein and native C. jejuni lysates

    • Verify specificity using atpB knockout strains as negative controls

    • Assess cross-reactivity with ATP synthase components from related species

    • Validate functionality in multiple applications (Western blot, immunoprecipitation, immunofluorescence)

  • Application-specific modifications:

    • For immunofluorescence, focus on epitopes accessible in intact cells

    • For immunoprecipitation of functional complexes, target exposed regions that don't disrupt complex assembly

    • For structural studies, develop Fab fragments that stabilize specific conformations

These considerations align with established approaches for developing antibodies against bacterial membrane proteins, including those used in C. jejuni research to study cellular localization and protein-protein interactions .

How can researchers address the challenge of atpB instability during purification?

Membrane protein instability is a common challenge in recombinant protein work. For C. jejuni atpB, several strategies can enhance stability during purification:

  • Optimized detergent selection:

    • Systematic screening of detergent types and concentrations

    • Consider mild detergents like DDM, LMNG, or GDN that better preserve membrane protein structure

    • Detergent mixtures may provide improved stability compared to single detergents

  • Lipid supplementation:

    • Add specific lipids found in C. jejuni membranes during purification

    • Create proteoliposomes or nanodiscs with defined lipid compositions

    • Use lipid-like molecules such as cholesterol hemisuccinate as stabilizers

  • Buffer optimization:

    • Screen various pH conditions to identify optimal stability range

    • Test different salt types and concentrations to mimic native environment

    • Add stabilizing agents like glycerol, sucrose, or specific binding partners

  • Temperature management:

    • Perform all purification steps at reduced temperatures (4°C)

    • Consider rapid purification protocols to minimize exposure time

    • Avoid freeze-thaw cycles that can destabilize membrane proteins

  • Covalent stabilization approaches:

    • Introduce disulfide bonds via engineered cysteines to stabilize specific conformations

    • Chemical crosslinking of flexible regions to reduce conformational heterogeneity

    • GFP fusion to monitor folding and stability in real-time

Stabilization StrategyMechanismImplementation ApproachSuccess Indicators
Native lipid additionProvides familiar membrane environmentAdd during extraction (0.1-0.5 mg/mL)Increased monodispersity on SEC
Amphipathic polymersReplace detergent with more stable alternativeExchange after initial purificationImproved thermal stability
NanodiscsDefined bilayer environmentMSP protein with lipid reconstitutionEnhanced long-term stability
Thermostability screeningIdentify optimal conditionsFluorescence-based thermal shift assaysIncreased melting temperature

These approaches have proven effective for stabilizing challenging membrane proteins and can be adapted specifically for C. jejuni atpB based on its particular characteristics.

How should researchers interpret functional differences between recombinant and native atpB?

When analyzing discrepancies between recombinant and native atpB function, a systematic approach to interpretation is essential:

  • Post-translational modification analysis:

    • Use mass spectrometry to identify modifications present in native but not recombinant protein

    • Common bacterial modifications include phosphorylation, methylation, and acetylation

    • C. jejuni-specific modifications may be present given its unique metabolism

  • Structural conformation assessment:

    • Compare secondary structure using circular dichroism spectroscopy

    • Evaluate tertiary structure using limited proteolysis patterns

    • Assess quaternary interactions with other ATP synthase components

  • Lipid environment differences:

    • Native membrane composition affects protein function

    • Reconstitution with C. jejuni lipid extracts may restore native-like function

    • Specific lipid requirements can be identified through add-back experiments

  • Protein interaction partners:

    • Native atpB functions within the complete ATP synthase complex

    • Co-purification experiments can identify missing interaction partners

    • Complementation with specific ATP synthase components may restore function

  • Expression system artifacts:

    • Codon usage differences between expression host and C. jejuni

    • Folding pathway variations between expression systems

    • Different chaperone availability affecting final conformation

A systematic analysis using these approaches helps distinguish genuine functional characteristics from artifacts of recombinant expression. For example, studies of other C. jejuni proteins have shown that their function can be significantly influenced by their native cellular context and interaction partners .

What statistical approaches are most appropriate for analyzing atpB mutant phenotypes?

The complex phenotypes often associated with ATP synthase mutations require robust statistical analysis approaches:

  • For growth phenotypes:

    • Mixed-effects models to account for both fixed effects (mutation, media conditions) and random effects (biological replicates)

    • Growth curve parameter extraction (lag phase, maximum growth rate, maximum density) followed by ANOVA with post-hoc tests

    • Survival analysis methods for stress tolerance experiments measuring time-to-death or growth inhibition

  • For biochemical assays:

    • Enzyme kinetics analysis using nonlinear regression to determine Vmax, Km for ATP synthase activity

    • Bootstrap resampling to generate confidence intervals for parameter estimates

    • Multiple comparison corrections (e.g., Bonferroni, Benjamini-Hochberg) when testing multiple mutants or conditions

  • For omics data integration:

    • Principal component analysis to identify major sources of variation between strains

    • Partial least squares discriminant analysis to identify metabolites or transcripts most strongly associated with specific mutations

    • Network analysis to understand system-wide impacts of atpB mutations on cellular metabolism

  • For microscopy/localization data:

    • Quantitative image analysis with appropriate controls for background and autofluorescence

    • Colocalization statistics such as Pearson's correlation coefficient or Manders' overlap coefficient

    • Spatial statistics for patterns of membrane protein distribution

  • Power analysis considerations:

    • A priori power analysis to determine appropriate sample sizes

    • Effect size calculations to quantify the magnitude of phenotypic changes

    • Consideration of biological versus technical replication strategies

How can researchers differentiate between ATP synthase effects and other energy metabolism pathways?

Distinguishing the specific contribution of ATP synthase from other energy metabolism pathways in C. jejuni requires targeted experimental approaches:

  • Specific inhibitor studies:

    • Use ATP synthase-specific inhibitors (e.g., oligomycin, DCCD) at sub-lethal concentrations

    • Compare with inhibitors of other energy metabolism components (e.g., rotenone, antimycin A)

    • Measure differential effects on ATP levels, membrane potential, and metabolic indicators

  • Genetic dissection approaches:

    • Create conditional mutants of atpB versus other energy metabolism genes

    • Use complementary gene silencing approaches (antisense RNA, CRISPRi)

    • Implement genetic suppressor screens to identify functional interactions

  • Metabolic flux analysis:

    • Use ¹³C-labeled substrates to track carbon flow through different pathways

    • Implement flux balance analysis models to predict pathway contributions

    • Compare theoretical versus experimental flux distributions under various conditions

  • Biochemical isolation:

    • Prepare inverted membrane vesicles to measure specific ATP synthase activity

    • Fractionate cellular components to isolate distinct energy-generating systems

    • Reconstitute purified components to assess individual contributions

  • Real-time monitoring approaches:

    • Use fluorescent ATP sensors to track ATP dynamics in living cells

    • Implement membrane potential-sensitive dyes to monitor proton motive force

    • Measure oxygen consumption and proton translocation simultaneously

ParameterATP Synthase InhibitionElectron Transport Chain InhibitionSubstrate-level Phosphorylation Inhibition
ATP levelsRapid decreaseGradual decreasePartial decrease
Membrane potentialMaintained or increasedCollapsedMinimally affected
Oxygen consumptionIncreasedDecreasedMinimal change
NADH/NAD⁺ ratioMinimal changeIncreasedVariable
Metabolic adaptationsUpregulation of substrate-level phosphorylationGlobal metabolic crisisPathway-specific rerouting

These approaches collectively provide a comprehensive framework for dissecting the specific contribution of ATP synthase to C. jejuni energy metabolism, accounting for the organism's unique microaerophilic nature and metabolic capabilities .

How might atpB be exploited as a target for novel antimicrobial development?

ATP synthase subunit a (atpB) represents a promising but underexplored target for novel antimicrobials against C. jejuni, offering several strategic advantages:

  • Structural uniqueness:

    • C. jejuni atpB likely contains species-specific structural features

    • The proton channel region might offer selective binding sites

    • Differences from human ATP synthase can provide selectivity

  • Essential function:

    • ATP synthesis is critical for C. jejuni survival

    • The microaerophilic nature of C. jejuni creates specific dependencies on efficient energy production

    • Limited metabolic flexibility makes ATP synthase inhibition particularly effective

  • Drug development approaches:

    • Structure-based drug design targeting C. jejuni-specific features

    • Peptide inhibitors mimicking natural protein-protein interfaces

    • Allosteric inhibitors affecting conformational changes during catalysis

    • Covalent inhibitors targeting accessible unique residues

  • Combination strategy potential:

    • ATP synthase inhibitors could synergize with existing antibiotics

    • Combined use with efflux pump inhibitors might be particularly effective

    • Phenolic compounds affecting membrane energetics could enhance efficacy

  • Delivery considerations:

    • Outer membrane penetration strategies for gram-negative-targeted compounds

    • Prodrug approaches for improved pharmacokinetics

    • Nanoparticle delivery systems for targeted therapy

This approach aligns with the growing interest in targeting bacterial energy metabolism as an alternative to traditional antibiotic targets, potentially addressing the increasing antibiotic resistance in C. jejuni . The unique metabolic characteristics of C. jejuni, particularly its oxygen requirements despite anaerobic electron transport chain capabilities , suggest that ATP synthase inhibition might be particularly effective against this pathogen.

What emerging technologies could advance our understanding of C. jejuni atpB structure and function?

Several cutting-edge technologies are poised to transform our understanding of C. jejuni atpB:

  • Cryo-electron microscopy advances:

    • Single-particle analysis reaching near-atomic resolution for membrane protein complexes

    • Tomography with subtomogram averaging for in situ structural studies

    • Time-resolved cryo-EM to capture dynamic states of ATP synthase

  • Integrative structural biology approaches:

    • Combining cryo-EM, X-ray crystallography, and NMR spectroscopy data

    • Mass spectrometry-based crosslinking to map protein-protein interactions

    • Molecular dynamics simulations to understand conformational dynamics

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing for precise manipulation of C. jejuni

    • Conditional gene expression systems for essential genes like atpB

    • Single-cell tracking of ATP synthase function in live bacteria

  • High-resolution imaging techniques:

    • Super-resolution microscopy to visualize ATP synthase distribution

    • Correlative light and electron microscopy (CLEM) for structural-functional studies

    • Atomic force microscopy for probing membrane protein topology

  • Systems biology integration:

    • Multi-omics approaches linking genotype to phenotype

    • Machine learning for identifying patterns in complex datasets

    • Genome-scale metabolic modeling incorporating ATP synthase function

These technologies will enable researchers to address fundamental questions about C. jejuni ATP synthase, including its unique adaptations for functioning in microaerophilic conditions, its role in pathogenesis, and its potential as a drug target. The combination of structural, functional, and systems-level approaches will provide unprecedented insights into this essential component of C. jejuni metabolism.

How can molecular dynamics simulations enhance our understanding of atpB function in C. jejuni?

Molecular dynamics (MD) simulations offer powerful insights into C. jejuni atpB function that experimental approaches alone cannot provide:

  • Proton translocation mechanism modeling:

    • Simulate proton movement through the atpB channel at atomistic resolution

    • Identify key residues involved in proton coordination

    • Calculate energy barriers for proton transfer events

  • Membrane-protein interactions:

    • Model atpB in a C. jejuni-mimetic lipid bilayer

    • Examine lipid-protein interactions that stabilize the protein

    • Investigate how membrane composition affects protein dynamics

  • Conformational dynamics analysis:

    • Simulate conformational changes during the catalytic cycle

    • Identify allosteric communication pathways within the protein

    • Calculate free energy landscapes for different functional states

  • Microaerophilic adaptation investigation:

    • Compare simulations at different oxygen concentrations

    • Model the effects of oxygen-dependent post-translational modifications

    • Investigate structural adaptations linked to C. jejuni's unique oxygen requirements

  • Drug binding studies:

    • Virtual screening of compound libraries against atpB

    • Structure-based drug design targeting C. jejuni-specific features

    • Binding free energy calculations for potential inhibitors

Practical implementation would involve:

  • Building homology models based on related bacterial ATP synthases

  • Embedding the model in a lipid bilayer with C. jejuni-specific composition

  • Running simulations on high-performance computing clusters

  • Analyzing trajectories for functional insights

  • Validating computational predictions with targeted experiments

These approaches would complement experimental studies, providing atomic-level insights into the unique features of C. jejuni ATP synthase that enable its function in the organism's specific ecological niche and during pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.