The recombinant protein is typically produced in E. coli expression systems and purified to greater than 90% purity as determined by SDS-PAGE analysis . This high purity level ensures reliable results in downstream research applications and structural studies.
The atpE protein functions as subunit c of the F0 sector in the ATP synthase complex, which is a critical enzyme responsible for ATP production in bacteria. Understanding the structural organization of ATP synthase provides context for appreciating the significance of the c subunit.
The c subunits play a crucial role in the rotational mechanism of ATP synthase. The structure of ATP synthase, with three αβ pairs in the F1 region and 10 c-subunits in the F0 region, results in symmetry mismatch between the 120° steps of the F1 motor and 36° steps of the F0 motor . By comparing the positions of equivalent c-subunits in different rotational states, the observed rotational step sizes in the three rotational states of the ATP synthase appear to be almost exactly 3, 4, and 3 c-subunits .
Each c subunit contains a conserved glutamate residue that can be protonated and deprotonated, allowing the c-ring to rotate as protons pass through the complex. This rotation couples the proton gradient across the membrane to the synthesis of ATP in the F1 sector :
Protons enter a periplasmic half-channel formed between subunit a and the c-ring
Protons bind to the conserved glutamate residue of a subunit c
The proton then rotates with the c-ring until it reaches the cytoplasmic half-channel
In the cytoplasmic half-channel, the proton is released due to interaction with a positively charged arginine residue of subunit a
Recombinant C. jejuni atpE is typically expressed in E. coli expression systems, allowing for efficient production of the protein for research applications . The addition of an N-terminal His tag facilitates purification using affinity chromatography techniques. After purification, the protein is typically provided as a lyophilized powder to ensure stability during storage and shipping .
ATP synthase plays a critical role in bacterial energy metabolism, and as a component of this complex, atpE is essential for C. jejuni survival and growth. The ATP synthase complex ensures the electron transfer between electron donors and the final electron acceptor, which is oxygen for aerobic and microaerobic bacteria like C. jejuni .
Given that C. jejuni is a microaerophilic organism, meaning it requires oxygen levels lower than atmospheric levels, its energy metabolism must be finely tuned to its environmental conditions. The ATP synthase complex, including the c subunit, is therefore adapted to function optimally under these microaerobic conditions .
C. jejuni is a major cause of food poisoning worldwide and remains the main infective agent in gastroenteritis and related intestinal disorders in Europe and the USA . While direct evidence linking atpE to C. jejuni virulence is limited, the ATP synthase complex as a whole is essential for bacterial survival and therefore indirectly contributes to the pathogen's ability to cause disease.
Recent research has identified various C. jejuni virulence factors through proteome analysis, including proteins involved in membrane structure and function . The membrane proteocomplexome of C. jejuni, which includes the ATP synthase complex, has been investigated using 2-D blue native/SDS PAGE, revealing 21 membrane protein complexes (MPCs) distributed in both inner and outer membranes . These MPCs, including the ATP synthase complex, are involved in various functions such as protein folding, molecule trafficking, oxidative phosphorylation, membrane structuration, peptidoglycan biosynthesis, motility and chemotaxis, stress signaling, efflux pumps, and virulence .
Comparing the atpE protein sequences from different Campylobacter species provides insights into evolutionary conservation and species-specific adaptations. For instance, the ATP synthase subunit c from Campylobacter hominis consists of 93 amino acids and shows both similarities and differences compared to the C. jejuni version :
| Species | Protein Length | Amino Acid Sequence | UniProt ID |
|---|---|---|---|
| C. jejuni | 112 aa | MKKVLFLLLACAAVAFAAEINAPVEQEAINVWIKAFSVLAAGLGLGVAALGGAIGMGNTAAATIAGTARNPGLGPKLMTTMFIALAMIEAQVIYALVIALIALYANPFIVLQ | Q5HUM3 |
| C. hominis | 93 aa | MISIYAQIASFSAIGVGIAIGVAACGGGIGMGIAANATILGMARNPSISSKLTTTMYISLAMIEAQVIYALVIVFILLYANPLLTETIAAAAK | A7I137 |
| C. jejuni subsp. doylei | 112 aa | MKKFLFLLLACAAVAFAAETNAPVEQEAINVWIKAFSVLAAGLGLGVAALGGAIGMGNTAAATIAGTARNPGLGPKLMTTMFIALAMIEAQVIYALVIALIALYANPFIVLQ | A7H3B5 |
Despite the differences in sequence length and composition, all three proteins maintain the essential structural features required for their function in the ATP synthase complex, particularly the conserved regions involved in proton translocation and interaction with other subunits of the complex.
Given the essential role of ATP synthase in bacterial survival, the c subunit represents a potential target for antimicrobial development. The structural differences between bacterial and human ATP synthases could potentially be exploited to develop selective inhibitors that target the bacterial enzyme without affecting the human counterpart.
C. jejuni is known to develop resistance to various antimicrobials, including macrolides and fluoroquinolones, often through the action of efflux pumps . Targeting essential cellular processes such as ATP synthesis could potentially provide alternative strategies to combat resistant strains.
While significant progress has been made in understanding the structure and function of bacterial ATP synthases, several knowledge gaps remain specific to C. jejuni atpE:
High-resolution structural data specifically for the C. jejuni ATP synthase complex
Detailed understanding of species-specific adaptations in the structure and function of the c subunit
Role of post-translational modifications in regulating the function of atpE
Advances in structural biology techniques, particularly cryo-EM, have revolutionized our understanding of complex molecular machines such as ATP synthase. Future research could leverage these techniques to obtain high-resolution structures of the C. jejuni ATP synthase complex in different functional states.
Additionally, proteomic approaches such as those used to study the membrane proteocomplexome of C. jejuni could provide insights into the interaction networks of atpE and its role in various cellular processes.
KEGG: cjr:CJE1014
Several expression systems have been documented for the production of recombinant C. jejuni atpE, with E. coli being the most commonly utilized. Research indicates that successful expression has been achieved using:
E. coli expression systems: Most frequently reported and commercially available recombinant atpE is produced in E. coli, likely using T7 or similar strong promoters .
Alternative expression hosts: While less common, other expression systems that have been utilized include:
When designing expression constructs, researchers should consider:
Adding affinity tags (such as His-tag) to facilitate purification
Optimizing codon usage for the chosen expression host
Appropriate signal peptides if secretion is desired
The choice of expression system should be guided by the specific research requirements, including the need for post-translational modifications, protein folding considerations, and final application of the recombinant protein .
Maintaining the stability of recombinant C. jejuni atpE requires specific storage conditions based on research findings:
| Storage Purpose | Temperature | Maximum Duration | Buffer Recommendations |
|---|---|---|---|
| Short-term use | 4°C | Up to 1 week | In working buffer |
| Medium-term storage | -20°C | Several months | With stabilizing agents (e.g., glycerol) |
| Long-term storage | -80°C | Years | With cryoprotectants |
Recommended storage protocol:
Store stock solutions at -20°C for routine storage
For extended storage periods, maintain at -80°C
Keep working aliquots at 4°C for up to one week
Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity
Store in buffer containing glycerol (typically 50% final concentration) to prevent freeze damage
Commercial preparations often come in a liquid form containing glycerol as a stabilizing agent. Storage buffers frequently include Tris-based or PBS-based formulations, sometimes supplemented with trehalose (6%) at pH 8.0 to enhance stability .
While atpE is not directly classified as a classical virulence factor, its role in energy metabolism is indirectly critical to C. jejuni pathogenesis:
Energy provision for virulence mechanisms: ATP synthase provides the energy required for various virulence processes, including motility, invasion, and toxin production. Research on C. jejuni virulence has demonstrated that energy-dependent processes are essential for successful host infection .
Adaptation to environmental stresses: During infection, C. jejuni must adapt to changing environments, including acid stress in the stomach. Studies have shown that C. jejuni modulates gene expression in response to acid shock, which may include adjustments in energy metabolism genes .
Relationship to known virulence factors: Genome-wide studies of C. jejuni have identified various virulence factors, including the cytolethal distending toxin (CDT) and MlaEFD proteins, which require energy for their synthesis and function. The atpE gene product contributes to this energy provision .
Survival in host environments: The ability of C. jejuni to survive in diverse host environments, including microaerophilic conditions in the gut, may depend on efficient energy metabolism systems including ATP synthase .
Research by Sałamaszyńska-Guz et al. (2022) demonstrated that alterations in C. jejuni protein expression can significantly impact virulence traits including biofilm formation, host cell attachment, and invasion .
To confirm the functionality of recombinant C. jejuni atpE, researchers can employ several complementary approaches:
Spectroscopic analysis:
Functional reconstitution assays:
Reconstitution into liposomes or membrane vesicles
Measurement of proton translocation activity using pH-sensitive fluorescent dyes
ATP synthesis assays in reconstituted systems
Binding studies:
Evaluation of interaction with other ATP synthase subunits
Assessment of binding to specific inhibitors
Genetic complementation:
Introduction of the recombinant atpE gene into atpE-deficient strains
Evaluation of restoration of ATP synthesis function in vivo
Structural integrity verification:
Size-exclusion chromatography to confirm oligomeric state
SDS-PAGE analysis under non-reducing and reducing conditions
Mass spectrometry to verify molecular mass and post-translational modifications
The specific method chosen should align with the research objectives and available laboratory resources. Combining multiple approaches provides the most robust verification of functionality .
The evolutionary aspects of atpE in Campylobacter species reveal important insights about bacterial adaptation and speciation:
Conservation across Campylobacter species: The atpE gene is conserved across Campylobacter species, reflecting its essential role in energy metabolism. Research on horizontal gene transfer in Campylobacter has shown that core metabolic genes like those encoding ATP synthase components can be subject to evolutionary pressures .
Horizontal gene transfer patterns: Studies have examined horizontal gene transfer (HGT) between C. jejuni and C. coli. While the uncA gene (encoding the ATP synthase alpha subunit) has been identified as subject to HGT between these species, the specific patterns for atpE are less documented but potentially similar .
Sequence variation among strains: Different strains of C. jejuni (such as serotype O:23/36 and serotype O:6) possess atpE genes with some sequence variations, which may reflect adaptation to different environmental niches or hosts .
Relationship to pathogenicity islands: The evolution of metabolic genes in Campylobacter may be linked to pathogenicity islands. Research has identified interactions between core metabolic functions and virulence factor expression, suggesting co-evolution of these systems .
The study by Sheppard et al. described in search result found that approximately 4.7% of C. jejuni sequence types contained imported alleles from C. coli, demonstrating interspecies genetic exchange that could potentially involve metabolic genes like atpE.
The interaction of atpE with other ATP synthase components follows a specific structural arrangement crucial for functional energy generation:
C-ring formation: Multiple copies of the atpE protein (typically 10-15 subunits) assemble to form the c-ring structure in the bacterial membrane, creating a central ion channel. This ring is essential for the rotary mechanism of ATP synthesis.
Interaction with a-subunit: The c-ring interfaces with the a-subunit (encoded by atpB) to form the complete proton channel. This interaction creates the pathway for proton translocation across the membrane.
Interaction with the F1 sector: The c-ring connects to the γ and ε subunits of the F1 sector, coupling proton movement through F0 to conformational changes in F1 that drive ATP synthesis.
Membrane integration: As demonstrated by research on membrane proteins in C. jejuni, atpE is integrated into the lipid bilayer through its hydrophobic transmembrane helices, with specific lipid interactions potentially important for function.
While the search results don't provide specific structural details about C. jejuni ATP synthase components, the general architecture of F-type ATP synthases is well conserved across bacterial species. Research tools that have been used to study protein-protein interactions in other C. jejuni systems, such as bacterial two-hybrid screens used to investigate the CtsP-CtsX interaction , could potentially be applied to study atpE interactions.
Purification of recombinant C. jejuni atpE presents specific challenges due to its hydrophobic nature as a membrane protein. Based on research practices, the following methodologies are most effective:
Affinity chromatography:
His-tag purification using immobilized metal affinity chromatography (IMAC) is the method of choice for His-tagged versions of the protein
Nickel or cobalt resins are commonly used with imidazole elution gradients
Typical binding buffers contain 20-50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, and 5-10 mM imidazole
Detergent solubilization strategies:
Mild detergents (n-dodecyl-β-D-maltoside, digitonin, or CHAPS) for initial membrane solubilization
Detergent concentration must be maintained above critical micelle concentration (CMC) throughout purification
Size exclusion chromatography (SEC):
Secondary purification step to remove aggregates and further purify the protein
Typically performed in buffers containing 0.03-0.05% of the selected detergent
Ion exchange chromatography:
Can be used as an additional purification step based on the protein's isoelectric point
Useful for removing contaminating proteins not separated by affinity methods
Assessment of purity:
A typical workflow combines affinity chromatography as the capture step, followed by SEC and/or ion exchange chromatography as polishing steps. Throughout the purification process, it's critical to maintain conditions that prevent protein aggregation due to the hydrophobic nature of membrane proteins.
Investigating the role of atpE in C. jejuni stress responses requires multi-faceted experimental approaches:
Genetic manipulation strategies:
Generation of atpE deletion mutants using methods similar to those described for other C. jejuni genes (e.g., clpB deletion using chloramphenicol resistance cassette insertion)
Complementation studies to confirm phenotype specificity
Site-directed mutagenesis of specific residues to identify critical functional domains
Stress exposure assays:
Transcriptomic and proteomic analysis:
In vivo models:
Energy metabolism measurements:
Measurement of ATP levels under different stress conditions
Membrane potential assessment using fluorescent probes
Oxygen consumption rate determination
Reid et al. demonstrated that C. jejuni modulates gene expression during acid shock and stomach transit, which could involve ATP synthase components as part of the metabolic adaptation to stress.
C. jejuni's adaptation to microaerophilic conditions is intricately linked to ATP synthase function:
Energy generation under oxygen limitation:
As a microaerophilic organism, C. jejuni has evolved specific mechanisms to generate energy under low oxygen conditions
ATP synthase plays a critical role in maintaining energy homeostasis in these environments
The atpE subunit contributes to the proton translocation machinery that functions effectively even under reduced oxygen levels
Integration with alternative respiratory pathways:
C. jejuni possesses alternative electron acceptors for respiration under microaerophilic conditions
ATP synthase integrates with these pathways to maintain energy production
Studies have shown C. jejuni upregulates genes involved in using nitrite as a terminal electron acceptor during stomach transit, which connects to energy generation systems
Oxygen-dependent regulation:
Experimental evidence:
Xu et al. (2015) demonstrated that "improved oxygen utilization efficiency of cells" helps overcome oxygen limitations in culture conditions , suggesting ATP synthase's role in energy metabolism is crucial for adaptation to microaerophilic environments.
Structural characterization of recombinant C. jejuni atpE requires specialized approaches for membrane proteins:
X-ray crystallography strategies:
Protein-detergent complexes can be prepared for crystallization trials
Lipidic cubic phase (LCP) crystallization may be particularly suitable
Examples of successful membrane protein structure determination, such as the case of Cj0982 (cysteine transporter) from C. jejuni, can provide methodological guidance
Addition of stabilizing antibody fragments or fusion partners may enhance crystallization success
Cryo-electron microscopy (Cryo-EM) approaches:
Single-particle analysis of purified ATP synthase complexes
Analysis of reconstituted atpE c-rings
Incorporation into nanodiscs or amphipols to maintain native-like environment
Nuclear Magnetic Resonance (NMR) studies:
Solution NMR for specific domains or fragments
Solid-state NMR for full-length protein in membrane mimetics
Selective isotopic labeling strategies to focus on functional regions
Computational prediction and modeling:
Homology modeling based on other bacterial ATP synthase c subunits
Molecular dynamics simulations to study conformational dynamics
Integration of experimental constraints with in silico approaches
Sample preparation considerations:
Protein must be maintained in detergent micelles or membrane mimetics
Concentration and buffer optimization is critical
Temperature stability must be assessed prior to structural studies
The structural study of C. jejuni Cj0982 (CjaA) described by Müller et al. provides a methodological framework that could be adapted for atpE structural studies. Their work used X-ray crystallography to determine the structure of this periplasmic binding protein and revealed important functional insights .
Multiple factors significantly impact the expression levels of recombinant C. jejuni atpE:
Expression system selection:
E. coli-based systems are most commonly used but may require optimization
Codon optimization for the host organism can significantly improve expression
Specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) often yield better results
Vector design considerations:
Growth and induction parameters:
Lower temperatures (16-25°C) during induction often improve membrane protein folding
Inducer concentration optimization (IPTG for T7-based systems)
Media composition affects biomass and protein yield
Growth phase at induction time influences expression success
Membrane protein-specific challenges:
Overexpression can lead to toxicity due to membrane crowding
Lipid composition of the host may affect proper insertion
Potential formation of inclusion bodies requires optimization of solubilization strategies
Post-induction handling:
Harvest timing optimization
Gentle cell lysis methods to preserve membrane integrity
Appropriate detergent selection for solubilization
Research conducted on other C. jejuni membrane proteins suggests that careful optimization of these parameters is essential. Studies with recombinant expression of C. jejuni proteins, including various ATP synthase subunits, have demonstrated that specialized approaches for membrane proteins significantly improve yields .
The relationship between atpE function and C. jejuni biofilm formation and colonization involves several interconnected processes:
Energy provision for biofilm-associated processes:
Connection to known biofilm regulators:
Studies of C. jejuni virulence factors have identified proteins like Peb4 that are critical for both biofilm formation and cell adhesion
As demonstrated by Asakura et al., deletion of the peb4 gene significantly reduced biofilm formation capacity
The energy provided by ATP synthase supports the function of these biofilm-regulating proteins
Metabolic adaptation during colonization:
C. jejuni must adapt its metabolism during different stages of host colonization
ATP synthase activity may be modulated to support changing energy demands during biofilm formation and host cell attachment
Proteomic analyses of C. jejuni mutants with impaired biofilm formation have revealed altered expression of proteins involved in energy metabolism
Empirical evidence from related studies:
Research on C. jejuni tlyA mutants demonstrated reduced biofilm formation, host cell attachment, invasion, and survival
These phenotypes were linked to changes in proteome composition, which could include altered energy metabolism
The fact that atpE supports these energy-demanding processes suggests its function is relevant to biofilm formation and colonization
The study by Asakura et al. demonstrated that the Peb4 mutant showed only 1-2% adherence capability compared to wild-type C. jejuni, along with reduced biofilm formation and mouse intestinal colonization ability .
Working with recombinant C. jejuni atpE presents several significant technical challenges that researchers must address:
Membrane protein solubility issues:
atpE is highly hydrophobic with multiple transmembrane domains
Requires careful detergent selection for solubilization
Risk of protein aggregation during purification and handling
Necessity to maintain detergent above critical micelle concentration throughout all procedures
Expression optimization difficulties:
Potential toxicity to host cells when overexpressed
Achieving proper membrane insertion in heterologous hosts
Balancing expression levels with proper folding
Selection of appropriate host strain and growth conditions
Structural characterization challenges:
Difficulty in obtaining crystals for X-ray crystallography
Challenges in obtaining sufficient quantities for NMR studies
Need for specialized methods like lipidic cubic phase crystallization or cryo-EM
Maintaining native structure in detergent micelles
Functional assessment limitations:
Complexity of reconstituting functional ATP synthase complexes
Difficulty separating atpE function from other ATP synthase components
Challenges in membrane reconstitution for functional studies
Limited availability of C. jejuni-specific assays
Stability concerns: