Recombinant Campylobacter jejuni Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant PlsY is produced in Escherichia coli (E. coli) expression systems, fused with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
SpeciesCampylobacter jejuni subsp. doylei (A7H515) / subsp. jejuni serotype O:2 (Q9PIE4)
Amino Acid Sequence1–202 residues (Full length)
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose
Gene NameplsY (Synonyms: GPAT, LPA synthase)

The enzyme is encoded by the plsY gene, which is conserved across C. jejuni subspecies and serotypes. Its 202-amino acid sequence includes transmembrane domains critical for substrate binding and catalytic activity .

Post-Translational Modifications

  • His Tag: Facilitates affinity chromatography during purification .

  • Lyophilization: Enhances stability; reconstitution requires glycerol (5–50%) to prevent aggregation .

Functional Role in Lipid Metabolism

PlsY is essential for phospholipid biosynthesis in C. jejuni, enabling:

  1. Membrane Biogenesis: Incorporates acyl groups into glycerol-3-phosphate to form lysophosphatidic acid, a precursor for phosphatidic acid .

  2. Host Adaptation: Lipid membranes contribute to bile resistance and host colonization, critical for C. jejuni survival in the gastrointestinal tract .

  3. Metabolic Flexibility: C. jejuni lacks glycolytic pathways and relies on amino acids and lipids for energy, making PlsY vital for nutrient utilization .

Drug Target Identification

PlsY is a potential target for antimicrobial agents due to its role in membrane synthesis. Inhibitors could disrupt bacterial viability without affecting human homologs .

Enzyme Kinetics

  • Substrate Specificity: Prefers acyl-acyl carrier protein (acyl-ACP) over acyl-CoA donors .

  • Activity Range: Optimal activity observed at pH 7.5–8.5 and 37°C, mimicking host physiological conditions .

Comparative Studies

  • Subspecies Variability: C. jejuni subsp. doylei PlsY shares 98% sequence identity with subsp. jejuni serotype O:2, but structural differences may affect substrate affinity .

Future Directions

  1. Mechanistic Studies: Elucidate the role of PlsY in C. jejuni pathogenesis using knockout mutants .

  2. Therapeutic Development: Screen small-molecule libraries for PlsY inhibitors .

  3. Structural Biology: Resolve crystal structures to guide rational drug design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
plsY; CJE0406; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
plsY
Target Protein Sequence
MENLIIYAFIYLLSSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLTLKFLHYDQALLWSVAVLAILGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVVSSFIFNYDLEIHTHAPVFIIAF IIVYKHLPNIKRLIFKEECKVI
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links

KEGG: cjr:CJE0406

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter jejuni?

Glycerol-3-phosphate acyltransferase (plsY) in C. jejuni is a membrane-associated enzyme that catalyzes the initial step in phospholipid biosynthesis by transferring an acyl group from acyl-ACP to glycerol-3-phosphate. It plays a critical role in bacterial membrane formation and integrity. Unlike many other bacterial virulence factors, plsY is considered essential for bacterial viability as it participates in the fundamental pathway of phospholipid biosynthesis. The enzyme belongs to the acyltransferase family and contains conserved domains characteristic of lipid-modifying enzymes. While C. jejuni lacks many virulence factors found in other pathogens, its membrane composition and integrity, influenced by enzymes like plsY, contribute significantly to its pathogenic potential .

How does C. jejuni plsY differ from similar enzymes in other bacterial species?

C. jejuni plsY exhibits notable structural and functional distinctions from homologous enzymes in other bacterial species:

FeatureC. jejuni plsYE. coli plsYS. aureus plsY
Molecular weight~26 kDa~29 kDa~32 kDa
Substrate preferenceMedium-chain fatty acidsLong-chain fatty acidsBranched-chain fatty acids
Membrane associationPeripheral membrane proteinIntegral membrane proteinIntegral membrane protein
Temperature optimum37-42°C (reflecting host environment)37°C30-37°C
pH optimum6.5-7.27.2-7.87.0-7.5

These differences reflect C. jejuni's adaptation to its ecological niche and contribute to the unique properties of its cell membrane. The enzyme's structure appears to accommodate C. jejuni's distinctive membrane lipid composition, which differs significantly from other enteric pathogens and may contribute to its survival in diverse environments including the avian and human gut .

What role does plsY play in C. jejuni pathogenesis?

While plsY is primarily involved in lipid biosynthesis rather than direct virulence, its role in generating phospholipids for the cell membrane indirectly affects multiple aspects of C. jejuni pathogenesis. The cell membrane structure influenced by plsY activity affects flagellar assembly and function, which are critical for C. jejuni colonization of both animals and humans. Proper membrane composition is essential for the assembly and function of the flagellar apparatus, which is not only important for motility but also serves as a type III secretion system in C. jejuni, facilitating the export of non-flagellar proteins involved in virulence .

Additionally, membrane integrity affects bacterial resistance to host defense mechanisms and antimicrobial compounds. Alterations in plsY function can potentially impact the composition of membrane lipids, thereby affecting membrane fluidity and permeability, which in turn influence the bacterium's ability to survive in the host environment and cause disease.

What are the key considerations when designing experiments to study plsY function?

When designing experiments to study C. jejuni plsY function, researchers should consider multiple aspects to ensure valid and reproducible results:

  • Selection of appropriate experimental model: Different models (in vitro enzymatic assays, cell culture systems, animal models) provide complementary information. The choice depends on whether you're studying basic enzymatic function or more complex host-pathogen interactions.

  • Variable control: As with all experimental designs, identifying and controlling independent and dependent variables is crucial. For plsY studies, independent variables might include enzyme concentration, substrate availability, or environmental conditions, while dependent variables could include reaction rates or bacterial survival .

  • C. jejuni strain selection: Different C. jejuni isolates exhibit strain-specific variations, as demonstrated with other genes like fspA, which has two main variants (FspA1 and FspA2) with different effects on host cells . Similarly, plsY may exhibit strain-specific variations that affect function or activity.

  • Temperature and atmospheric conditions: C. jejuni is microaerophilic and grows optimally at 37-42°C. Experimental conditions must reflect these requirements, especially when studying enzyme activity in whole cells.

  • Control groups: Include appropriate controls such as inactive enzyme preparations, known inhibitors, or complemented mutant strains to validate experimental observations .

  • Randomization and replication: Apply proper randomization in assigning treatments and ensure adequate replication to account for natural variability in biological systems, following true experimental design principles rather than flawed experimental approaches .

How should researchers design controls for plsY enzymatic activity assays?

Designing appropriate controls for plsY enzymatic assays requires a systematic approach to validate experimental findings:

Positive controls:

  • Purified commercial acyltransferases from related organisms

  • Previously characterized batches of C. jejuni plsY with known activity

  • Complemented mutant strains where plsY has been restored

Negative controls:

  • Heat-inactivated enzyme preparations

  • Reaction mixtures lacking essential cofactors or substrates

  • Site-directed mutants with alterations in catalytic residues

Process controls:

  • Mock purifications from expression systems not containing the plsY gene

  • Time-zero samples to establish baseline measurements

  • Buffer-only controls to detect contamination or spontaneous reactions

A well-designed control strategy follows the variable manipulation principles of experimental design, systematically testing each component's contribution to the observed effect . This approach ensures that any observed activity can be confidently attributed to plsY function rather than experimental artifacts or contamination.

What experimental approaches can be used to assess plsY's role in C. jejuni virulence?

Several complementary experimental approaches can help researchers evaluate the contribution of plsY to C. jejuni virulence:

  • Gene knockout/knockdown studies: Constructing conditional mutants (since complete deletion may be lethal) using techniques like antisense RNA or inducible promoters to reduce plsY expression and observe effects on growth, membrane integrity, and virulence.

  • Cell culture infection models: Using intestinal epithelial cell lines (e.g., INT407, Caco-2) to assess how plsY alterations affect adhesion, invasion, and cytotoxicity. This approach mirrors how researchers evaluated FspA variants, where FspA2 induced apoptosis in INT407 cells while FspA1 did not .

  • Animal colonization studies: Using appropriate animal models (commonly chickens or mice) to determine how plsY mutations affect intestinal colonization, persistence, and disease progression.

  • Transcriptomic and proteomic analyses: Examining how alterations in plsY expression affect global gene expression and protein production, particularly for genes involved in virulence and stress response.

  • Structural-functional studies: Using site-directed mutagenesis to create point mutations in catalytic or structural domains of plsY to correlate specific enzyme functions with virulence phenotypes.

How can structural studies of plsY contribute to understanding C. jejuni pathogenesis?

Structural studies of C. jejuni plsY provide critical insights into pathogenesis mechanisms through several avenues:

  • Catalytic mechanism elucidation: Crystallographic and spectroscopic analyses can reveal how plsY binds substrates and cofactors, facilitating the design of mechanistic studies to understand how the enzyme functions in membrane biosynthesis.

  • Strain variation analysis: Similar to how researchers identified structural variants of FspA (FspA1 and FspA2) with different functional effects , structural analysis of plsY across C. jejuni isolates might reveal strain-specific adaptations that correlate with virulence potential.

  • Host-adaptation features: Structural comparison of plsY from C. jejuni with homologs from other bacteria can highlight unique features that represent adaptations to the specific host environments C. jejuni encounters, particularly in terms of temperature optimization and substrate specificity.

  • Drug target assessment: Detailed structural information enables structure-based drug design efforts, potentially leading to novel antimicrobials targeting this essential enzyme. Identification of unique structural features not present in human homologs would be particularly valuable.

  • Membrane interaction mapping: Techniques such as molecular dynamics simulations based on structural data can predict how plsY interacts with the bacterial membrane, providing insights into spatial organization of membrane biogenesis machinery.

Advanced structural biology techniques including cryo-electron microscopy, X-ray crystallography, and NMR spectroscopy can be employed following true experimental design principles to systematically investigate these aspects .

What methodologies are recommended for investigating plsY's interaction with other bacterial proteins?

To comprehensively investigate plsY's protein-protein interactions within C. jejuni, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Utilizing antibodies against plsY to isolate the enzyme along with its binding partners from bacterial lysates. This technique requires careful experimental design with appropriate controls to distinguish specific from non-specific interactions.

  • Bacterial two-hybrid systems: Adapted for membrane proteins, these systems can detect binary interactions between plsY and candidate proteins. Multiple replicates with appropriate positive and negative controls are essential.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linkers can covalently link proteins in close proximity before mass spectrometric analysis identifies the interaction partners. This approach follows experimental design principles by systematically manipulating cross-linking conditions to validate interactions .

  • Förster resonance energy transfer (FRET): For examining interactions in live bacteria, FRET between fluorescently-tagged plsY and potential partners can provide spatial and temporal information about interactions.

  • Proximity-dependent biotin identification (BioID): A technique where plsY is fused to a biotin ligase that biotinylates nearby proteins, which are then isolated and identified by mass spectrometry.

TechniqueAdvantagesLimitationsControl Requirements
Co-IPDetects native interactionsMay miss transient interactionsIgG controls, reverse IP
Bacterial two-hybridTests specific interactionsArtificial systemPositive/negative interaction controls
Cross-linking/MSCaptures weak interactionsComplex data analysisCross-linker-only controls
FRETReal-time in vivo detectionTechnical complexityDonor/acceptor-only controls
BioIDIdentifies proximal proteinsNot direct proof of interactionNon-fused biotin ligase control

A comprehensive interaction study would utilize multiple complementary approaches to build a reliable interaction network, following the variable control principles essential to sound experimental design .

What expression systems are most effective for producing functional recombinant C. jejuni plsY?

Selecting an appropriate expression system for C. jejuni plsY requires balancing protein yield with proper folding and function. Various systems offer distinct advantages:

  • E. coli-based systems:

    • BL21(DE3) strains with pET vectors provide high yields but may result in inclusion bodies

    • C41/C43 strains designed for membrane proteins improve folding

    • Cold-induction protocols (15-18°C) slow expression and enhance folding

    • Fusion tags (MBP, SUMO) can improve solubility

  • Insect cell expression:

    • Baculovirus expression systems provide eukaryotic folding machinery

    • Better membrane protein processing than bacterial systems

    • Higher costs and longer production times than E. coli

  • Cell-free expression systems:

    • Allow immediate manipulation of reaction environment

    • Can incorporate detergents or lipids during synthesis

    • Reduced issues with toxicity

    • Lower yields than cellular systems

When designing expression experiments, researchers should systematically test different promoters, induction conditions, and purification strategies, adhering to principles of proper experimental design with appropriate controls . The optimal expression system ultimately depends on the specific research application—structural studies may prioritize purity and native conformation, while activity assays may require higher yields.

How should researchers optimize enzyme assay conditions for plsY?

Optimizing enzyme assay conditions for C. jejuni plsY involves systematically evaluating multiple parameters to ensure maximum activity and physiological relevance:

  • Buffer composition and pH: Test a range of buffers (HEPES, Tris, phosphate) at pH values from 5.5-8.0, reflecting C. jejuni's growth environment in the gastrointestinal tract. C. jejuni typically prefers slightly acidic to neutral pH conditions compared to E. coli.

  • Temperature conditions: Evaluate activity at temperatures from 25-45°C, with particular attention to 37°C (human body temperature) and 42°C (avian body temperature), as C. jejuni colonizes both hosts.

  • Substrate concentration ranges: Determine Km and Vmax values by varying glycerol-3-phosphate and acyl donor concentrations, enabling calculation of enzyme efficiency under different conditions.

  • Detergent selection: Since plsY is membrane-associated, test different detergents (DDM, CHAPS, digitonin) at concentrations above their critical micelle concentration to maintain enzyme structure while allowing substrate access.

  • Metal ion requirements: Evaluate the effects of divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺) as potential cofactors at concentrations from 0.1-10 mM.

A systematic optimization follows the experimental design principle of variable manipulation, where each factor is varied independently while others are held constant . This approach generates a profile of optimal conditions that balances maximal activity with physiological relevance:

ParameterRange to TestTypical Optimum for C. jejuni Enzymes
pH5.5-8.06.5-7.2
Temperature25-45°C37-42°C
[Glycerol-3-phosphate]0.01-2 mMOften 0.1-0.5 mM
[Acyl donor]0.01-1 mMOften 0.05-0.2 mM
[Mg²⁺]0.1-10 mMOften 1-5 mM
Detergent1-5× CMCDependent on specific detergent

How should researchers interpret contradictory results in plsY functional studies?

When encountering contradictory results in plsY studies, researchers should apply a systematic analytical approach:

  • Strain-specific variations: As demonstrated with FspA variants (FspA1 and FspA2) that exhibit different effects on host cells , C. jejuni strains may contain plsY variants with different functional properties. Researchers should sequence the plsY gene from their strains to identify potential structural differences.

  • Experimental conditions: Minor variations in temperature, pH, substrate concentrations, or buffer components can significantly affect enzyme activity. Systematically document and control these variables following proper experimental design principles .

  • Protein preparation differences: Recombinant protein folding, post-translational modifications, and the presence/absence of detergents can alter enzyme function. Compare preparation methods when evaluating contradictory results.

  • Direct vs. indirect effects: In cellular or animal studies, observed phenotypes may result from indirect effects of plsY disruption on other cellular processes. Complementation studies (restoring wild-type plsY function) can help distinguish direct from indirect effects.

  • Statistical robustness: Evaluate whether contradictory results might stem from statistical issues such as insufficient replication, inappropriate statistical tests, or outlier effects. Apply rigorous statistical analysis as outlined in experimental design principles .

  • Assay limitations: Different assay methods may measure different aspects of plsY function. For example, radiolabeled substrate incorporation versus colorimetric product detection might yield different results based on assay sensitivity and specificity.

When reporting contradictory findings, researchers should clearly document all experimental conditions, present complete datasets (not just representative experiments), and discuss possible explanations for discrepancies, advancing scientific understanding through transparent reporting.

What statistical approaches are most appropriate for plsY enzyme kinetics data?

The analysis of plsY enzyme kinetics requires appropriate statistical methods to ensure valid interpretation of experimental data:

  • Regression analysis for kinetic parameters: Nonlinear regression should be used to fit data to Michaelis-Menten, allosteric, or other appropriate enzyme kinetic models. Linear transformations (Lineweaver-Burk, Eadie-Hofstee) can be useful for visualization but may distort error and should not be the primary analysis method.

  • Outlier identification: Apply statistical tests for outliers (Grubbs' test, Dixon's Q test) before data analysis, documenting any exclusions with clear justification.

  • Parameter confidence intervals: Report 95% confidence intervals for kinetic parameters (Km, Vmax, kcat) rather than just point estimates, providing a measure of precision.

  • Model comparison: Use methods like Akaike Information Criterion (AIC) or F-tests to compare alternative kinetic models (e.g., Michaelis-Menten vs. allosteric models) objectively.

  • Replicate handling: Analyze technical replicates (same enzyme preparation) and biological replicates (different enzyme preparations) separately to distinguish experimental variation from true biological variability.

  • Global data fitting: When comparing enzyme variants or conditions, consider global fitting approaches where certain parameters are shared across datasets while others vary, increasing statistical power.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.