Recombinant Campylobacter jejuni Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; CJE0410; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
lspA
Target Protein Sequence
MAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGFRWQSEYLDLTYALNTGVAFSMLSFLEH NLKYLHLALIGVLFIYLFWQRTLLKTHSIAFGMMLGAGVSNLLDRFIHGGVVDMFFWHKW FNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: cjr:CJE0410

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Lipoprotein Signal Peptidase (LspA) in Campylobacter jejuni?

LspA in C. jejuni functions as a specialized type II signal peptidase that specifically cleaves the signal peptide from prolipoproteins after lipid modification, which is crucial for the proper localization and function of lipoproteins. This processing is essential for C. jejuni viability as lipoproteins play diverse roles in bacterial pathogenesis and physiology, including cell adhesion, transport, nutrient acquisition, mating, and serum resistance, as well as stimulation of inflammatory/immune responses in host cells . Unlike general peptidases, LspA specifically recognizes and processes the conserved lipobox motif in prolipoprotein signal sequences, making it a critical enzyme in the lipoprotein maturation pathway.

How does LspA processing relate to other characterized lipoproteins in C. jejuni?

LspA processes numerous lipoproteins in C. jejuni, including functionally characterized ones such as JlpA, CapA, CjaA, and FlpA . JlpA, a surface-exposed lipoprotein, interacts with host heat shock protein 90α (Hsp90α) and triggers signaling pathways leading to NF-κB and p38 MAP kinase activation . CapA is involved in adherence to host epithelial cells and colonization of the chicken gastrointestinal tract . CjaA is an inner-membrane associated lipoprotein that, when expressed in avirulent Salmonella, reduces C. jejuni colonization in chickens . Improper processing by LspA would likely impair the functions of these lipoproteins, affecting C. jejuni's ability to adhere to and colonize host tissues.

How does the genomic context of lspA compare to other peptidase-encoding genes in C. jejuni?

Within the C. jejuni genome, lspA exists among over 45 identified peptidase-related proteins . While some peptidases like PepP of the M24 family have been specifically characterized as virulence factors , and others like HtrA have been shown to cleave tight junction proteins to enable paracellular translocation , the genomic context of lspA indicates its essential nature in processing many lipoproteins. Unlike some peptidase genes that may be part of operons, lspA typically functions independently, though its expression may be coordinated with genes involved in lipoprotein biosynthesis and transport pathways.

What are the optimal expression systems for producing recombinant C. jejuni LspA?

For recombinant expression of C. jejuni LspA, E. coli-based systems with tightly controlled inducible promoters are preferred due to the potential toxicity of this membrane-embedded protease. The pET expression system with BL21(DE3) host cells, used for similar membrane proteins, provides efficient expression when induced with IPTG at lower temperatures (16-25°C) to prevent inclusion body formation. For functional studies, a C-terminal His-tag is preferred over N-terminal tagging, as the latter might interfere with membrane insertion. Codon optimization for E. coli expression is recommended since C. jejuni has different codon usage patterns, which can affect translation efficiency and protein folding kinetics.

What challenges are encountered when purifying recombinant LspA and how can they be overcome?

Purification of recombinant LspA presents several challenges due to its nature as a membrane-embedded enzyme. First, extraction requires careful selection of detergents—mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration effectively solubilize LspA while maintaining its native conformation. Second, during affinity chromatography, including 0.05-0.1% detergent in all buffers prevents protein aggregation. Third, the hydrophobic nature of LspA often results in lower expression yields, which can be addressed by scaling up culture volumes or using specialized expression strains like C41(DE3) designed for membrane proteins. Finally, purified LspA tends to lose activity during storage; this can be mitigated by adding 10-20% glycerol to storage buffers and maintaining aliquots at -80°C rather than subjecting the protein to freeze-thaw cycles.

How can researchers verify the proper folding and activity of purified recombinant LspA?

Verification of properly folded and active recombinant LspA requires multiple complementary approaches. Circular dichroism spectroscopy can confirm secondary structure integrity by analyzing characteristic spectra patterns typical of membrane proteins. Thermal shift assays using fluorescent dyes can assess protein stability and proper folding. For activity verification, in vitro enzymatic assays using synthetic fluorogenic peptide substrates containing the lipobox motif can measure cleavage activity through fluorescence detection. Additionally, mass spectrometry can detect the specific cleavage products from known prolipoprotein substrates. Western blotting with antibodies specific to processed versus unprocessed forms of model lipoproteins provides further validation of functional activity. These multi-faceted approaches collectively confirm that the recombinant LspA retains its native structure and catalytic capabilities.

What are the established methods for measuring LspA enzymatic activity in vitro?

Several robust methods exist for measuring LspA activity in vitro. The most direct approach utilizes fluorescence resonance energy transfer (FRET)-based peptide substrates containing the consensus lipoprotein signal sequence with a fluorophore and quencher pair flanking the cleavage site. Upon cleavage, increased fluorescence can be quantitatively measured in real-time. Alternatively, HPLC-based assays can separate and quantify cleaved peptide products. For more complex analysis, mass spectrometry can precisely identify cleavage sites in both synthetic and natural substrates. These assays should be conducted with appropriate controls, including heat-inactivated enzyme and known LspA inhibitors like globomycin, to validate specificity. Optimal assay conditions include pH 8.0, temperature of 37-42°C (reflecting C. jejuni's optimal growth temperature), and the presence of divalent cations like Mg²⁺ or Zn²⁺, which often enhance LspA activity.

How can researchers investigate the substrate specificity of C. jejuni LspA?

Investigating substrate specificity of C. jejuni LspA requires a multifaceted approach combining in silico analysis with experimental validation. Begin with bioinformatic prediction of C. jejuni lipoproteins using programs like LipoP or PRED-LIPO to identify proteins with signal peptides containing the lipobox motif. Next, synthesize peptides representing these predicted cleavage sites and examine processing efficiency using in vitro assays. Site-directed mutagenesis of key residues within the lipobox motif (typically L-[A/S/T]-[G/A]-C) can determine critical sequence requirements. For whole-cell experiments, express FLAG or His-tagged versions of predicted lipoproteins in C. jejuni wild-type and lspA-depleted strains, then use Western blotting to detect changes in molecular weight indicating processing. Comparative proteomics of membrane fractions between wild-type and lspA-depleted strains can also reveal the full spectrum of natural substrates, providing a comprehensive map of LspA's substrate landscape in C. jejuni.

What techniques are available for inhibiting LspA activity in C. jejuni for functional studies?

Researchers have multiple options for inhibiting LspA activity in C. jejuni. Chemical inhibition can be achieved using globomycin or related compounds, which are specific inhibitors of lipoprotein signal peptidases. For genetic approaches, creating a conditional knockout is recommended since lspA is likely essential, similar to other bacteria. This can be accomplished using an inducible promoter system where lspA expression depends on the presence of an inducer molecule. Alternatively, antisense peptide nucleic acid (PNA) technology, which has been successfully used for other genes in C. jejuni , can specifically reduce LspA expression levels without complete elimination. CRISPR interference (CRISPRi) systems adapted for C. jejuni provide another method for tunable repression of lspA expression. For transient inhibition studies, heterologous expression of a catalytically inactive LspA variant (with mutations in active site residues) can create a dominant-negative effect by competing with the native enzyme for substrate binding.

How does LspA activity contribute to C. jejuni virulence and host colonization?

LspA activity is crucial for C. jejuni virulence and host colonization through its essential role in processing numerous lipoproteins that directly mediate pathogenesis. By ensuring proper maturation of adhesins like JlpA and CapA, LspA enables C. jejuni to adhere to intestinal epithelial cells . Similarly, processing of lipoproteins like Cj0091, which has been demonstrated to be critical in early colonization of the chicken intestinal tract, directly impacts C. jejuni's ability to establish infection . LspA-processed lipoproteins also contribute to immune evasion, nutrient acquisition in the restrictive host environment, and resistance to host defense mechanisms. The significance of this processing is evidenced by studies of other characterized lipoproteins in C. jejuni, where mutations affecting their localization severely impair virulence. Since LspA would affect multiple virulence-associated lipoproteins simultaneously, its inhibition would likely have profound effects on multiple aspects of C. jejuni pathogenesis.

What experimental models best demonstrate the role of LspA-processed lipoproteins in C. jejuni pathogenesis?

The most informative experimental models for studying LspA's role in C. jejuni pathogenesis combine in vitro cell culture systems with in vivo animal models. For in vitro studies, intestinal epithelial cell lines like INT 407 provide excellent systems to measure adhesion and invasion capabilities of wild-type versus LspA-depleted strains . Transepithelial electrical resistance (TEER) assays using polarized cell monolayers can assess the ability of C. jejuni to disrupt epithelial barriers. For in vivo models, the microbiota-depleted IL-10⁻/⁻ mouse model has proven particularly valuable, as it develops acute, non-self-limiting C. jejuni enterocolitis that mimics human disease . This model allows researchers to assess colonization efficiency, histopathological changes, and inflammatory responses. The chicken colonization model provides additional insights into commensal-like interactions. In both models, comparing wild-type C. jejuni with strains expressing catalytically inactive LspA or depleted LspA levels can reveal the comprehensive contribution of properly processed lipoproteins to pathogenesis across different host environments.

How can structural biology approaches enhance our understanding of C. jejuni LspA function?

Advanced structural biology approaches would significantly deepen our understanding of C. jejuni LspA by revealing critical molecular features that determine its substrate specificity and catalytic mechanism. X-ray crystallography of purified recombinant LspA, though challenging with membrane proteins, would provide atomic-level resolution of the active site architecture. Cryo-electron microscopy (cryo-EM) offers an alternative approach that may better accommodate the membrane-embedded nature of LspA. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions undergoing conformational changes upon substrate binding. Molecular dynamics simulations based on structural data would further illuminate the dynamic interactions between LspA and its substrates within the membrane environment. These structural insights would have immediate applications in structure-based drug design targeting LspA, potentially leading to novel antimicrobials against C. jejuni. Additionally, comparing structural features with LspA homologs from other pathogens could reveal species-specific characteristics that might explain differences in substrate processing efficiency or inhibitor sensitivity.

What are the most promising approaches for developing LspA-targeted antimicrobials against C. jejuni?

Developing LspA-targeted antimicrobials against C. jejuni represents a promising therapeutic strategy given the enzyme's essential nature. High-throughput screening of chemical libraries against purified recombinant LspA can identify novel inhibitor scaffolds beyond the known globomycin class. Structure-guided medicinal chemistry can then optimize these hits for improved potency, selectivity, and pharmacokinetic properties. Peptide-based inhibitors mimicking the lipobox motif but resistant to cleavage offer another approach, potentially providing higher specificity than small molecule inhibitors. Fragment-based drug discovery, which identifies small chemical fragments that bind to different regions of LspA and then links them to create high-affinity compounds, has proven successful for other challenging targets. Natural product screening, particularly from soil bacteria known to produce antibiotics targeting other organisms' cell envelope processes, may yield novel LspA inhibitor classes. The most promising candidates would show selective inhibition of bacterial LspA without affecting human enzymes, demonstrate efficacy in reducing C. jejuni colonization in animal models, and maintain activity under gastrointestinal conditions where C. jejuni infections occur.

How might LspA processing affect the immunogenicity of C. jejuni lipoproteins and vaccine development?

LspA processing fundamentally alters the immunogenicity of C. jejuni lipoproteins, making this enzyme indirectly critical for vaccine development strategies. Properly processed lipoproteins with their lipid moieties exposed often serve as potent Toll-like receptor 2 (TLR2) agonists, stimulating innate immune responses and enhancing adaptive immunity. This adjuvant-like property makes LspA-processed lipoproteins potentially valuable components in subunit vaccine formulations. Importantly, studies from other bacterial systems suggest that the specific pattern of lipid modification, which depends on proper signal peptide cleavage by LspA, significantly impacts recognition by the host immune system. For vaccine development, researchers could explore creating attenuated C. jejuni strains with modified LspA activity that process lipoproteins to enhance their immunogenicity without contributing to pathogenesis. Alternatively, recombinant lipoproteins produced with controlled LspA processing could be purified and incorporated into subunit vaccines. Comparative immunological studies of wild-type versus alternatively processed lipoproteins would reveal optimal configurations for stimulating protective immunity while minimizing inflammatory damage, advancing efforts to develop an effective vaccine against this prevalent foodborne pathogen.

What are the primary technical challenges in differentiating between LspA-processed and unprocessed lipoproteins in C. jejuni?

Differentiating between LspA-processed and unprocessed lipoproteins in C. jejuni presents several technical challenges that require specialized approaches. The primary difficulty is the relatively small size difference (approximately 2-3 kDa) between processed and unprocessed forms, which can be difficult to resolve using standard SDS-PAGE. To overcome this, researchers should employ high-resolution Tricine-SDS-PAGE systems specifically designed for low molecular weight proteins. Alternatively, phos-tag acrylamide gels can enhance separation based on the different charge characteristics of processed versus unprocessed lipoproteins. For more precise analysis, mass spectrometry-based approaches offer superior resolution, with liquid chromatography-tandem mass spectrometry (LC-MS/MS) enabling identification of specific cleavage sites. Another challenge is the hydrophobic nature of lipoproteins, which can cause precipitation during sample preparation; this can be addressed using specialized detergent combinations like ASB-14 with CHAPS. Finally, generating antibodies that specifically recognize the processed or unprocessed forms enables western blotting approaches that can clearly distinguish between processing states regardless of subtle size differences.

How can researchers effectively isolate membrane fractions to study LspA localization and activity?

Effective isolation of membrane fractions to study LspA localization and activity requires careful optimization of fractionation protocols specific to C. jejuni's unique cell envelope. Begin with cells harvested in exponential growth phase and utilize a combination of gentle enzymatic digestion (with lysozyme) and mechanical disruption (via sonication) in hypotonic buffer to maximize cell lysis while preserving membrane integrity. Differential ultracentrifugation should follow, with initial low-speed centrifugation (5,000 × g) to remove unbroken cells, followed by higher-speed centrifugation (100,000 × g) to pellet total membranes. For separating inner and outer membranes, sucrose density gradient centrifugation provides the most reliable results, with gradients of 30-60% sucrose typically showing good separation. Alternatively, selective detergent solubilization using sarkosyl (0.5-2%) preferentially solubilizes inner membrane proteins while leaving outer membrane components in the insoluble fraction. Verification of fraction purity should employ marker proteins like MOMP (outer membrane) and specific respiratory enzymes (inner membrane). For activity assays in membrane fractions, inclusion of protease inhibitors is critical to prevent degradation of LspA by other membrane proteases during the isolation procedure.

How does C. jejuni LspA compare to homologous enzymes in other foodborne pathogens?

C. jejuni LspA shares core structural and functional features with homologs in other foodborne pathogens, but also exhibits distinctive characteristics reflecting Campylobacter's unique physiology. Sequence alignment analysis reveals that C. jejuni LspA retains the catalytic aspartate residues essential for peptidase activity found in E. coli and Salmonella homologs, but shows approximately 40-45% sequence identity, indicating potential differences in substrate specificity or regulation. Unlike LspA from Gram-positive pathogens like Listeria monocytogenes, C. jejuni LspA functions in the context of a Gram-negative envelope with distinctly different lipoprotein transport pathways. Functionally, while LspA is essential in most foodborne pathogens, C. jejuni's microaerophilic lifestyle and unique outer membrane composition may impose different selective pressures on LspA function. Notably, C. jejuni LspA processes lipoproteins like JlpA and CapA that contain species-specific sequences around the lipobox motif , potentially requiring adaptations in substrate recognition not present in other pathogens' enzymes.

What can comparative genomics tell us about the evolution and conservation of LspA across Campylobacter species?

Comparative genomics reveals that LspA is highly conserved across Campylobacter species, reflecting its essential function in lipoprotein processing within this genus. Sequence analysis shows >90% amino acid identity among C. jejuni strains, indicating strong selective pressure to maintain LspA structure and function. Examination of synonymous versus non-synonymous substitution rates (dN/dS ratio) in lspA genes across Campylobacter species suggests purifying selection, with most variations occurring in regions not critical for catalytic activity. The genomic context of lspA is similarly conserved, with flanking genes typically involved in fundamental cellular processes rather than virulence-specific functions. This pattern differs from some other peptidases in Campylobacter that show greater strain-to-strain variability. Interestingly, while the catalytic core of LspA remains highly conserved, subtle variations exist in regions likely involved in substrate recognition, potentially reflecting adaptations to process species-specific lipoproteins in different Campylobacter species that occupy diverse ecological niches, from human pathogens like C. jejuni to non-pathogenic environmental species.

How do findings about LspA compare with other known virulence-associated peptidases in C. jejuni?

Findings about LspA in C. jejuni reveal important distinctions when compared to other characterized virulence-associated peptidases like HtrA and PepP. While PepP (a peptidase of the M24 family) has been directly linked to inflammatory responses and tissue damage during infection , LspA's role appears more fundamental and widespread, affecting multiple virulence pathways through its processing of numerous lipoproteins. Unlike HtrA, which directly contributes to virulence by cleaving host proteins like occludin and E-cadherin to facilitate paracellular translocation , LspA's effects are mediated entirely through its bacterial substrates. From a regulatory perspective, while the CmeR repressor and CosR response regulator modulate expression of other peptidase genes in response to environmental conditions , LspA expression likely maintains more consistent levels due to its housekeeping function. Structurally, LspA's membrane-embedded topology differs significantly from soluble peptidases like PepP, requiring different approaches for biochemical characterization. These comparisons highlight the diverse roles of peptidases in C. jejuni pathogenesis, with LspA representing a class that affects virulence through fundamental processes rather than through direct interaction with host substrates.

What emerging technologies could advance our understanding of LspA in C. jejuni pathogenesis?

Several emerging technologies hold promise for advancing our understanding of LspA in C. jejuni pathogenesis. CRISPR interference (CRISPRi) adapted for C. jejuni would enable precise temporal control over lspA expression, allowing researchers to determine the effects of LspA depletion at different stages of infection. Advanced imaging techniques like super-resolution microscopy could reveal the spatial organization of LspA within the membrane and its co-localization with substrates during processing. Single-cell RNA sequencing of host cells infected with wild-type versus LspA-depleted C. jejuni strains would provide unprecedented insights into cell-specific responses to LspA-processed lipoproteins. Cryo-electron tomography could visualize the native membrane architecture containing LspA and its substrates at near-atomic resolution. Biomolecular condensate analysis might reveal whether LspA participates in membrane microdomains that concentrate lipoprotein processing machinery. Host-microbiome interaction studies using gnotobiotic models with defined microbiota would clarify how LspA-dependent functions affect C. jejuni's competitive fitness in the intestinal environment. These emerging approaches would collectively provide a more comprehensive understanding of LspA's multifaceted roles in C. jejuni pathogenesis.

What research gaps remain in our understanding of the interplay between LspA and host immune responses?

Significant research gaps remain regarding the interplay between LspA and host immune responses. First, the specific immunomodulatory effects of properly processed versus unprocessed C. jejuni lipoproteins on different host immune cell populations remain largely uncharacterized. Second, the relative contribution of LspA-processed lipoproteins to pathogen-associated molecular pattern (PAMP) recognition by TLR2 versus other innate immune receptors requires clarification. Third, how LspA-dependent lipoprotein processing affects C. jejuni's susceptibility to host antimicrobial peptides is poorly understood. Fourth, the potential of LspA-processed lipoproteins to serve as protective antigens for adaptive immunity remains unexplored. Fifth, the temporal dynamics of host immune recognition of lipoproteins during different stages of infection lacks detailed characterization. Additionally, the role of LspA in C. jejuni persistence during chronic infection states, particularly in immunocompromised hosts, represents another significant knowledge gap. Addressing these questions would require advanced immunological techniques including single-cell analysis, spatial transcriptomics of infected tissues, and longitudinal studies in relevant animal models with defined genetic backgrounds.

How might systems biology approaches enhance our understanding of LspA's role in the C. jejuni cellular network?

Systems biology approaches would provide comprehensive insights into LspA's position within C. jejuni's cellular networks. Multi-omics integration combining transcriptomics, proteomics, lipidomics, and metabolomics data from wild-type and LspA-depleted strains would reveal the cascading effects of lipoprotein processing disruption across multiple cellular systems. Network analysis could identify hub proteins whose functions are particularly dependent on LspA processing, potentially revealing new therapeutic targets. Flux balance analysis incorporating LspA-dependent pathways would predict how alterations in lipoprotein processing affect metabolic capabilities and stress responses. Agent-based modeling simulating C. jejuni population behavior during infection could predict emergent properties resulting from LspA inhibition. Systems-level comparison of LspA depletion effects across multiple strains would reveal strain-specific dependencies on LspA function that might explain variations in virulence. Additionally, dual RNA-seq approaches simultaneously capturing both bacterial and host transcriptomes during infection would provide integrated views of how LspA-dependent processes shape host-pathogen interactions at the systems level. These approaches would collectively transform our understanding of LspA from a single enzyme to a critical node in complex regulatory and functional networks governing C. jejuni pathophysiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.