Recombinant Campylobacter jejuni Macrolide export ATP-binding/permease protein MacB (macB)

Shipped with Ice Packs
In Stock

Description

Introduction to Campylobacter jejuni and Antibiotic Resistance

Campylobacter jejuni is a pathogenic bacterium recognized as one of the most common causes of bacterial enterocolitis globally. This microorganism is predominantly associated with poultry and frequently detected in animal feces, serving as a leading cause of food poisoning across Europe and the United States . As a helical-shaped, Gram-negative, microaerophilic bacterium, C. jejuni possesses remarkable adaptability through mechanisms including phase variation, quorum sensing, and extensive glycosylation systems .

The pathogenicity of C. jejuni manifests through its ability to disrupt intestinal mucosa, leading to symptoms ranging from watery diarrhea to dysentery. More severe complications may include Guillain-Barré syndrome, occurring approximately 100 times more frequently in individuals with recent C. jejuni infections compared to the general population . The bacterium's virulence is enhanced by its capacity to navigate viscous environments, targeting intestinal mucus for colonization and subsequently breaching epithelial barriers .

A critical aspect of C. jejuni's survival is its ability to resist antimicrobial compounds, particularly through specialized efflux systems. Among these, the MacB protein represents a sophisticated molecular machinery designed for the targeted expulsion of specific antibiotics from the bacterial cell.

Molecular Identity and Characterization of MacB Protein

MacB functions as a macrolide-specific ATP-binding cassette (ABC) efflux transporter in Campylobacter jejuni. This protein belongs to a broader class of membrane transporters that utilize the energy from ATP hydrolysis to actively transport substances across biological membranes . The MacB protein was initially identified through experimental studies as a novel ABC-type macrolide efflux transporter, representing the first experimentally confirmed ABC antibiotic efflux transporter in Gram-negative bacteria .

The genetic foundation of MacB lies within the macAB gene cluster, which encodes both the MacB protein and its functional partner, MacA. Research demonstrates that neither gene produces antibiotic resistance independently, highlighting the cooperative nature of this transport system . The MacB protein is characterized by its integral membrane position and specific functional domains that enable its role in antibiotic efflux.

The MacAB-TolC Efflux System

MacB functions as part of a tripartite efflux system in conjunction with two additional protein components: MacA and TolC. Together, these proteins form a continuous channel that traverses both the inner and outer membranes of Gram-negative bacteria, enabling the direct export of antimicrobial compounds from the cytoplasm to the extracellular environment .

MacA belongs to the membrane fusion protein (MFP) family and contains a signal-like sequence at its N-terminus. As a peripheral membrane protein, MacA serves as an essential adaptor between MacB and TolC, facilitating the assembly and function of the complete efflux system . TolC, a multifunctional outer membrane channel, provides the final conduit through which antibiotics exit the cell.

The cooperative nature of this system is evidenced by experimental findings demonstrating that neither MacA nor MacB alone confers antibiotic resistance. Instead, both components must be expressed simultaneously, along with the outer membrane channel TolC, to establish effective macrolide resistance . This interdependence underscores the sophisticated molecular machinery evolved by bacteria to combat antimicrobial challenges.

Substrate Specificity and Resistance Profile

The MacAB-TolC system demonstrates selective specificity toward macrolide antibiotics, particularly those composed of 14- and 15-membered lactone rings. Notably, the system exhibits limited or no resistance against macrolides containing 16-membered lactones . This substrate discrimination highlights the precision with which bacterial efflux systems have evolved to target specific classes of antimicrobial compounds.

This selective resistance profile may reflect evolutionary adaptations to commonly encountered antibiotics within the bacterium's environment or host. The specificity may also suggest structural constraints within the transport channel or substrate binding sites that limit the range of compounds capable of being effluxed.

Recombinant Production and Characteristics

Recombinant Campylobacter jejuni MacB protein is produced through molecular cloning and expression techniques that enable the isolation and purification of the protein for research and diagnostic applications. Commercial preparations typically yield quantities around 50 μg, stored in Tris-based buffer with 50% glycerol to maintain protein stability and functionality .

Role in Campylobacter jejuni Pathogenesis

While the primary function of MacB centers on antibiotic resistance, its role may extend to broader aspects of Campylobacter jejuni pathogenesis and host-pathogen interactions. As an efflux transporter, MacB could potentially contribute to bacterial survival within host environments by expelling host-derived antimicrobial compounds or facilitating adaptation to changing conditions during infection.

Campylobacter jejuni employs numerous virulence mechanisms to colonize and invade host tissues, including chemotactically controlled motility, disruption of epithelial junctions, and cytotoxin production . The bacteria can persist within host cells for extended periods, avoiding lysosomal destruction and inducing inflammatory pathways that contribute to disease manifestation . Within this complex pathogenic process, efflux systems like MacB may provide crucial support by maintaining cellular homeostasis and countering host defense molecules.

Connection to Epithelial Barrier Disruption

Campylobacter jejuni demonstrates the ability to disrupt polarized epithelial monolayers, particularly in intestinal cell lines. Research using T84 cell monolayers shows significant reduction in transepithelial electrical resistance following C. jejuni infection, accompanied by increased permeability and morphological alterations in desmosomes . These effects appear to be mediated by bacterial invasion, as pharmacological inhibition of invasion pathways reduces barrier disruption .

The potential connection between MacB function and epithelial barrier disruption remains an area for further investigation. As a component of bacterial stress response and adaptation systems, MacB may indirectly support the invasive capabilities of C. jejuni by enhancing survival during host-pathogen interaction.

Research Applications and Diagnostic Significance

Recombinant MacB protein serves valuable purposes in research and diagnostic applications. As a purified protein preparation, it enables detailed structural studies, functional assays, and antibody production for immunological detection methods. ELISA (Enzyme-Linked Immunosorbent Assay) applications utilizing recombinant MacB provide sensitive detection of Campylobacter jejuni in clinical and environmental samples .

The availability of recombinant MacB facilitates investigations into antibiotic resistance mechanisms, offering opportunities to develop targeted interventions that might overcome efflux-mediated resistance. Furthermore, as a bacterial component with defined function, MacB represents a potential target for novel antimicrobial strategies focused on efflux inhibition rather than direct bacterial killing.

Comparison with Other Bacterial Efflux Systems

The MacAB-TolC system in Campylobacter jejuni shares functional similarities with other tripartite efflux systems found across Gram-negative bacteria, yet maintains distinct characteristics that reflect its specialized role in macrolide resistance. Unlike constitutive multidrug efflux transporters such as AcrAB-TolC, which exhibit broad substrate specificity, the MacAB system demonstrates a narrower substrate profile focused primarily on specific macrolide antibiotics .

This specialization suggests that the MacAB system evolved in response to particular selective pressures, possibly related to the environmental niches occupied by Campylobacter jejuni or its interactions with hosts that produce or contain macrolide-like compounds. The system's selective advantage likely balances the energetic costs of maintaining dedicated efflux machinery against the survival benefits conferred by macrolide resistance.

Future Research Directions

The study of recombinant Campylobacter jejuni MacB protein opens several promising avenues for future research. Structural biology approaches, including X-ray crystallography and cryo-electron microscopy, could provide atomic-level insights into the protein's conformation and mechanism of action. Such detailed structural information would advance understanding of substrate recognition and transport processes.

Functional investigations might explore the regulatory mechanisms governing MacB expression and activity, potentially revealing environmental triggers or signaling pathways that modulate efflux system function during infection. Additionally, the development of specific inhibitors targeting MacB or its interactions with partner proteins represents a rational approach to combating antibiotic resistance in Campylobacter jejuni.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
macB; CJE0710; Macrolide export ATP-binding/permease protein MacB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-641
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
macB
Target Protein Sequence
MIFLKNICKNIGENAILKNVSLSIEKGEFVAIIGQSGSGKTSLLNIIGTLDTPSSGTYVF DEYEVTKLNNDEKARLRREKIGFIFQRYNLLSLLSAKENVSLPAVYAGKNLQERSQNAKK LLNDLELAHKLDSKPNELSGGQQQRVSIARALINGGELILADEPTGALDSKSGIMVLEIL QKLNEQGHTIVLVTHDPKIAAQAKRVIEIKDGEILSDTKKEKAQEKLILKTMPKEKKTLT LLKNQAFECFKIAYSSILAHKLRSILTMLGIIIGIASVVCVVALGLGSQAKVLESIARLG TNTIEIRPGKGFGDLRSGKTRLNFSDLETLRSLEYLEAVDAHSNTSGVATYTNISLSARA EGVGVNNFAIEGLRIDAGRILNNDDVKNSTNVAVLDFNAKKNLFPDEKSENILGRVVLFN SQSFKIIGVLQKDTDKPIEDNVVRLYIPYTTLMNKLTGDRNLREIIVKVKDDVSSTLAEN AIIRILEIKRGQKDFFTFNSDTFKQAITANKRTTTILTACVAVIALIVGGIGVMNIMLVS VSERTREIGIRMAIGARREDIMMQFLIEAVMICTIGAILGVILSIFVIFAFNTLSTDFPM ILNAYSVLLGLLSSMFIGVVFGFFPARNAANLNPISALSKE
Uniprot No.

Target Background

Function
This protein is a non-canonical ABC transporter containing transmembrane domains (TMDs), which form a pore in the inner membrane, and an ATP-binding domain (NBD), responsible for energy generation. It confers resistance against macrolides.
Database Links

KEGG: cjr:CJE0710

Protein Families
ABC transporter superfamily, Macrolide exporter (TC 3.A.1.122) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MacB protein in Campylobacter jejuni and what is its primary function?

The MacB protein in C. jejuni is a macrolide export ATP-binding/permease protein that functions as part of a multi-component efflux pump system, specifically the MacAB-putC complex. This membrane protein complex (MPC) is embedded in the bacterial membrane and is organized into functional units that participate in molecule trafficking and antimicrobial resistance . The primary function of MacB is to export macrolide antibiotics and potentially other antimicrobial compounds from the bacterial cell, contributing to the organism's intrinsic resistance mechanisms.

Unlike isolated proteins, MacB operates as part of a functional complex spanning the membrane, working in conjunction with MacA (a membrane fusion protein) and putC (an outer membrane protein) to form a complete efflux system . The transport mechanism involves ATP hydrolysis to provide energy for the active efflux of substrates across the membrane barrier.

How is the macB gene regulated in C. jejuni?

Research has identified that the MacAB-putC efflux system in C. jejuni is regulated through a distinct mechanism involving the CosR (Campylobacter oxidative stress regulator) transcription factor. Genomic analysis has revealed the presence of a consensus sequence CosR-binding box in the promoter regions of the MacAB-putC operon specifically in C. jejuni strains, while this regulatory element is notably absent in C. coli . This species-specific regulation suggests different evolutionary adaptation paths for macrolide resistance mechanisms between these closely related Campylobacter species.

The CosR regulator responds to oxidative stress conditions, potentially linking macrolide resistance with oxidative stress response in C. jejuni. This regulatory mechanism may explain why certain environmental conditions influence the expression of macrolide resistance in clinical and environmental isolates of C. jejuni.

What methodologies are used for expression and purification of recombinant C. jejuni MacB protein?

The expression and purification of recombinant C. jejuni MacB typically employs a multi-step process:

  • Gene cloning: The macB gene from C. jejuni (typically strain 81-176 or other well-characterized strains) is amplified using PCR with high-fidelity DNA polymerase. The gene is then cloned into an expression vector, commonly using systems like pET or pBAD that allow controlled expression.

  • Expression system: For membrane proteins like MacB, specialized expression systems such as E. coli C43(DE3) or Lemo21(DE3) strains are preferred as they are engineered to better accommodate membrane protein overexpression.

  • Extraction and solubilization: Membrane protein extraction requires careful optimization of detergents. For MacB, mild non-ionic detergents such as n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are typically employed to maintain the native conformation.

  • Purification techniques: Affinity chromatography (using His-tags or other fusion tags) followed by size exclusion chromatography is commonly used to obtain pure protein. Blue-native PAGE can be used to verify that the protein maintains its native oligomeric state .

The optimization of membrane detergent concentration is particularly critical for successful extraction of intact membrane protein complexes like MacB, as demonstrated in studies utilizing two-dimensional blue native/SDS-PAGE techniques .

How does the structure-function relationship of C. jejuni MacB differ from other bacterial homologs?

The C. jejuni MacB protein shares structural similarities with other bacterial ABC transporters but exhibits distinct characteristics that reflect its specialized function in Campylobacter species. While comprehensive structural studies specific to C. jejuni MacB are still emerging, comparative analysis with homologs suggests several key differences:

  • Transmembrane domains: C. jejuni MacB likely contains four transmembrane helices, similar to other MacB proteins, but may have species-specific variations in the periplasmic domains that influence substrate specificity.

  • Nucleotide-binding domains (NBDs): These domains in C. jejuni MacB contain Walker A and B motifs and signature sequences typical of ABC transporters, but sequence alignments reveal subtle differences that may affect ATP binding and hydrolysis kinetics.

  • Periplasmic domain architecture: This domain is crucial for substrate recognition and interaction with partner proteins. In C. jejuni, this region likely contains structural adaptations that facilitate interaction with the putC outer membrane component rather than TolC, which is the partner in many other bacterial species.

For functional research, site-directed mutagenesis of conserved versus divergent residues between C. jejuni MacB and other bacterial homologs can provide insights into the significance of these structural differences. Combining these approaches with in vitro antimicrobial susceptibility testing allows researchers to correlate structural features with functional outcomes.

What is the relationship between the MacAB-putC and CmeABC efflux systems in C. jejuni, and how do they contribute to antimicrobial resistance?

Research on the membrane proteocomplexome of C. jejuni has revealed an unexpected relationship between the subunits of two major efflux pumps: MacAB-putC and CmeABC . While these systems have traditionally been studied as separate entities, proteocomplexomic analysis suggests potential functional interactions or complementary roles.

The CmeABC efflux system is well-characterized in C. jejuni and contributes to resistance against multiple antibiotics including macrolides, fluoroquinolones, and tetracyclines. The relationship with MacAB-putC appears to be complex and potentially involves:

  • Substrate overlap: Both systems may export similar antimicrobial compounds, particularly macrolides, providing redundancy in resistance mechanisms.

  • Regulatory crosstalk: There may be coordinated regulation of both efflux systems, potentially through common transcriptional regulators.

  • Structural cooperation: The protein components may physically interact or form higher-order complexes under specific conditions.

Research methodologies to explore this relationship include:

  • Generating single and double knockout mutants of both efflux systems to assess changes in antimicrobial susceptibility profiles

  • Transcriptomic analysis to identify co-regulation patterns

  • Co-immunoprecipitation or cross-linking studies to detect physical interactions between components of both systems

This relationship has significant implications for understanding and potentially targeting antimicrobial resistance mechanisms in C. jejuni.

How can MacB-focused research contribute to addressing antimicrobial resistance in C. jejuni clinical isolates?

The emergence of antimicrobial-resistant Campylobacter is a serious public health concern, with resistance to macrolides (such as erythromycin and azithromycin) being particularly problematic as these are often drugs of choice for treating campylobacteriosis . MacB-focused research offers several avenues for addressing this challenge:

  • Efflux pump inhibitor (EPI) development: Understanding the structure and function of MacB can inform the design of specific inhibitors that could restore antibiotic susceptibility. A methodological approach involves:

    • Virtual screening of compound libraries against MacB structural models

    • Biochemical validation using ATPase assays

    • Combination testing of candidate EPIs with antibiotics against resistant isolates

  • Surveillance and diagnostics: Molecular markers in the MacAB-putC system can be developed for rapid detection of resistant strains. Current antimicrobial resistance surveillance in Campylobacter focuses primarily on phenotypic resistance patterns , but understanding MacB variations could enhance molecular surveillance.

  • Alternative therapeutic approaches: Targeting MacB regulatory mechanisms, such as the CosR regulator, could provide alternative strategies for combating resistance.

Table 1 below compares resistance patterns in C. jejuni and C. coli isolates, highlighting the importance of understanding species-specific resistance mechanisms:

Antimicrobial resistanceC. jejuni (n=651)C. coli (n=336)
Tetracycline (TET) only33.5%15.5%
Ciprofloxacin-Nalidixic acid-Tetracycline15.7%16.1%
Ciprofloxacin-Nalidixic acid6.8%19.9%
Azithromycin-Clindamycin-Erythromycin0.2%13.7%
Azithromycin-Erythromycin0.2%5.7%

Data adapted from antimicrobial resistance patterns in Campylobacter isolates

These resistance patterns underscore the importance of understanding specific resistance mechanisms, including the role of efflux pumps like MacAB-putC, particularly for macrolide resistance which shows marked differences between C. jejuni and C. coli.

What methodological approaches can be used to study the interaction between MacB and environmental stress responses in C. jejuni?

The relationship between MacB expression and environmental stress responses in C. jejuni is a complex area that requires sophisticated methodological approaches. This is particularly relevant given the finding that MacAB-putC is regulated by CosR, a stress response regulator . Several experimental designs can address this relationship:

  • Stress exposure experiments: Exposing C. jejuni to various stressors (oxidative, temperature, osmotic) and measuring changes in MacB expression through:

    • RT-qPCR for transcriptional analysis

    • Western blotting with MacB-specific antibodies for protein expression

    • Reporter gene constructs (e.g., lacZ fusions to macB promoter) for promoter activity

  • Survival assays under combined stress and antimicrobial exposure: This can be conducted similar to methods used for studying C. jejuni survival at low temperatures and under aerobic conditions , but with the addition of macrolide antibiotics. The methodology includes:

    • Preparing standardized bacterial suspensions (e.g., OD600 of 0.8)

    • Incubating under various stress conditions with and without antibiotics

    • Periodic sampling and enumeration of viable cells on selective media

    • Comparing wild-type with macB deletion mutants

  • Proteomic approaches: Using techniques like the two-dimensional blue native/SDS PAGE employed in the membrane proteocomplexome study to identify changes in MacB interaction partners under stress conditions.

  • In vitro evolution experiments: Subjecting C. jejuni to gradually increasing levels of stress and antibiotic pressure, followed by whole genome sequencing to identify mutations in macB or its regulators.

These approaches can reveal whether MacB functions primarily as an antibiotic resistance mechanism or has broader roles in stress adaptation and bacterial physiology.

How does the protozoan host interaction with C. jejuni affect the expression and function of the MacB efflux system?

Research has shown that C. jejuni can interact with and survive within protozoan hosts such as Acanthamoeba polyphaga, which may provide protection against otherwise lethal conditions . The relationship between this host interaction and MacB function represents an intriguing area for investigation:

  • Co-cultivation studies: Methods for this investigation would include:

    • Establishing co-cultures of C. jejuni and A. polyphaga using standardized protocols

    • Treating with macrolide antibiotics at various concentrations

    • Comparing survival rates between wild-type and macB mutant strains

    • Measuring macB expression in intracellular versus extracellular bacteria

  • Intracellular adaptation analysis: This would involve:

    • Recovering C. jejuni from within amoebae after various periods of intracellular residence

    • Assessing changes in antimicrobial susceptibility profiles

    • Measuring alterations in macB expression and regulation using transcriptomic approaches

    • Determining whether intracellular residence alters the composition or function of MacAB-putC complexes

  • Stress response correlation: Determining whether the protective effect of protozoan hosts correlates with changes in bacterial stress responses that might influence MacB function.

This research direction is particularly relevant given that environmental reservoirs, including protozoan hosts, may contribute to the persistence and spread of antimicrobial-resistant C. jejuni in water sources and food production environments .

What are the optimal expression conditions for producing functional recombinant C. jejuni MacB protein for structural studies?

Obtaining sufficient quantities of functional membrane proteins like MacB presents significant technical challenges. For researchers pursuing structural studies of C. jejuni MacB, the following methodological considerations are critical:

  • Expression system optimization:

    • Host selection: While E. coli is commonly used, specialized strains like C43(DE3) or Lemo21(DE3) better accommodate membrane protein overexpression. For proteins that resist expression in E. coli, alternative systems like Lactococcus lactis or cell-free expression systems may be considered.

    • Vector design: Incorporating fusion tags that enhance folding (such as MBP) in addition to purification tags can improve yield of functional protein.

    • Induction parameters: Lower induction temperatures (16-20°C) and reduced inducer concentrations often improve folding of membrane proteins.

  • Membrane extraction and protein solubilization:

    • Detergent screening: A panel of detergents should be systematically tested, beginning with mild non-ionic detergents like DDM, LMNG, or UDM.

    • Solubilization conditions: Buffer composition, pH, ionic strength, and the presence of stabilizing agents (glycerol, specific lipids) significantly impact the extraction of functional MacB.

  • Functional verification methods:

    • ATPase activity assays: Confirming that the purified protein maintains ATP hydrolysis activity.

    • Substrate binding assays: Using fluorescent or radiolabeled macrolide antibiotics to verify substrate interaction.

    • Reconstitution into proteoliposomes: To assess transport function in a membrane environment.

The optimization process should be guided by functional assays at each step to ensure that the protein maintains its native activity throughout the purification process.

How can cryo-electron microscopy be optimized for structural determination of the complete MacAB-putC complex from C. jejuni?

Determining the structure of the complete MacAB-putC complex requires specialized approaches within cryo-electron microscopy (cryo-EM) methodology:

  • Sample preparation considerations:

    • Complex stability: The tripartite complex must be stabilized, potentially using chemical crosslinking agents such as glutaraldehyde or BS3 to prevent dissociation.

    • Detergent selection: Amphipols, nanodiscs, or saposin-lipoprotein nanoparticles often provide better contrast in cryo-EM compared to detergent micelles.

    • Grid optimization: Testing various grid types (Quantifoil, C-flat) and hole sizes, as well as glow discharge parameters to achieve optimal particle distribution.

  • Data collection strategy:

    • Heterogeneity analysis: Implementing 3D classification to sort out different conformational states of the complex.

    • Multiple conformational states: Capturing the complex with different nucleotides (ATP, ADP, non-hydrolyzable ATP analogs) to understand the transport cycle.

    • Focused refinement: Employing masked refinement of specific regions of the complex to improve local resolution.

  • Validation approaches:

    • Antibody labeling: Using Fab fragments against specific components to verify the locations of MacA, MacB, and putC within the complex.

    • Nanobody-aided crystallography: For regions that remain difficult to resolve by cryo-EM alone.

    • Integrative structural biology: Combining cryo-EM with complementary techniques such as cross-linking mass spectrometry (XL-MS) or small-angle X-ray scattering (SAXS).

This multifaceted approach can overcome the challenges inherent in membrane protein complex structural determination and provide insights into the functional architecture of the complete efflux system.

How do macrolide resistance mechanisms involving MacB differ between C. jejuni and C. coli?

Comparative analysis of macrolide resistance mechanisms between these two Campylobacter species reveals significant differences that may inform species-specific approaches to combating antimicrobial resistance:

  • Regulatory differences:

    • The presence of a CosR-binding box in the promoter regions of MacAB-putC in C. jejuni but not in C. coli suggests fundamentally different regulatory mechanisms .

    • Methodological approach: Comparative promoter analysis using electrophoretic mobility shift assays (EMSA) with purified CosR protein and promoter regions from both species.

  • Resistance prevalence patterns:

    • C. coli exhibits significantly higher rates of macrolide resistance compared to C. jejuni (13.7% vs. 0.2% for Azithromycin-Clindamycin-Erythromycin resistance) .

    • Methodological approach: Comparative genomic analysis of the macAB-putC locus and surrounding regions in matched resistant and susceptible isolates of both species.

Table 2: Comparison of resistance mechanisms between C. jejuni and C. coli

MechanismC. jejuniC. coli
CosR regulation of MacAB-putCPresentAbsent
Prevalence of macrolide resistanceLower (0.2-0.5%)Higher (5.7-13.7%)
Primary resistance determinantsLikely efflux-mediatedOften target modification (23S rRNA mutations)
  • Functional analysis approaches:

    • Gene complementation studies introducing C. jejuni macB into C. coli and vice versa

    • Chimeric protein expression to identify species-specific functional domains

    • Comparative transcriptomic and proteomic analysis under macrolide exposure

This comparative approach can yield insights into why these closely related species exhibit such marked differences in macrolide resistance prevalence and mechanisms.

What are the evolutionary implications of the differences in MacB function and regulation across Campylobacter species?

Evolutionary analysis of MacB across Campylobacter species provides insight into adaptation processes and selective pressures:

  • Phylogenetic analysis methodology:

    • Multiple sequence alignment of MacB proteins from diverse Campylobacter species and strains

    • Selection pressure analysis using dN/dS ratios to identify regions under positive selection

    • Ancestral sequence reconstruction to trace the evolutionary history of key functional domains

  • Horizontal gene transfer assessment:

    • Analysis of GC content, codon usage bias, and flanking mobile genetic elements

    • Comparative analysis of MacB phylogeny versus species phylogeny to detect incongruence

  • Ecological context correlation:

    • Comparing MacB sequences from isolates from different hosts (poultry, cattle, human clinical) to identify host-specific adaptations

    • Analysis of MacB variants in relation to environmental persistence, such as the ability to survive at low temperatures or aerobic conditions

This evolutionary perspective can reveal whether differences in MacB between C. jejuni and C. coli represent ancient divergence or more recent adaptation to specific ecological niches or antibiotic selection pressures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.